Property Summary

NCBI Gene PubMed Count 36
PubMed Score 258.66
PubTator Score 95.51

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count P-value
ovarian cancer 8520 3.3e-04
psoriasis 6694 1.4e-03
hereditary spastic paraplegia 318 7.1e-03
Disease Target Count Z-score Confidence
Systemic lupus erythematosus 194 0.0 2.4
Disease Target Count Z-score Confidence
Pyruvate decarboxylase deficiency 16 5.783 2.9
Leigh disease 100 3.716 1.9

Expression

  Differential Expression (3)

Disease log2 FC p
hereditary spastic paraplegia -1.032 7.1e-03
ovarian cancer 1.800 3.3e-04
psoriasis 1.100 1.4e-03

Protein-protein Interaction (2)

Gene RIF (13)

AA Sequence

MAASWRLGCDPRLLRYLVGFPGRRSVGLVKGALGWSVSRGANWRWFHSTQWLRGDPIKILMPSLSPTMEE      1 - 70
GNIVKWLKKEGEAVSAGDALCEIETDKAVVTLDASDDGILAKIVVEEGSKNIRLGSLIGLIVEEGEDWKH     71 - 140
VEIPKDVGPPPPVSKPSEPRPSPEPQISIPVKKEHIPGTLRFRLSPAARNILEKHSLDASQGTATGPRGI    141 - 210
FTKEDALKLVQLKQTGKITESRPTPAPTATPTAPSPLQATAGPSYPRPVIPPVSTPGQPNAVGTFTEIPA    211 - 280
SNIRRVIAKRLTESKSTVPHAYATADCDLGAVLKVRQDLVKDDIKVSVNDFIIKAAAVTLKQMPDVNVSW    281 - 350
DGEGPKQLPFIDISVAVATDKGLLTPIIKDAAAKGIQEIADSVKALSKKARDGKLLPEEYQGGSFSISNL    351 - 420
GMFGIDEFTAVINPPQACILAVGRFRPVLKLTEDEEGNAKLQQRQLITVTMSSDSRVVDDELATRFLKSF    421 - 490
KANLENPIRLA                                                               491 - 501
//

Text Mined References (44)

PMID Year Title