Property Summary

NCBI Gene PubMed Count 80
Grant Count 148
R01 Count 101
Funding $25,686,940.86
PubMed Score 640.35
PubTator Score 2885.84

Knowledge Summary

Patent (6,395)

Expression

  Differential Expression (14)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.545 0.012
malignant mesothelioma -1.500 0.000
cutaneous lupus erythematosus 1.800 0.001
osteosarcoma -3.801 0.000
cystic fibrosis 1.245 0.002
medulloblastoma, large-cell -1.600 0.001
juvenile dermatomyositis -1.262 0.000
lung cancer -2.800 0.000
interstitial cystitis 1.600 0.001
primary Sjogren syndrome 1.700 0.001
subependymal giant cell astrocytoma 1.162 0.020
gastric carcinoma 1.100 0.031
ulcerative colitis 2.000 0.000
ovarian cancer -1.600 0.000

Synonym

Accession O00329 A6NCG0 G1FFP1 O15445 Q5SR49 PI3-kinase subunit delta
Symbols APDS
PI3K
IMD14
p110D
P110DELTA

Gene

PANTHER Protein Class (2)

PDB

5DXU  

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (101)

PMID Text
26770665 Impaired signaling and protein synthesis through the PI3K catalytic subunit p110delta is an underlying molecular defect and potential treatment target in select autism spectrum disorders.
26540567 Bone marrow stroma-induced resistance of chronic lymphocytic leukemia cells to arsenic trioxide involves Mcl-1 upregulation and is overcome by inhibiting the PI3Kdelta or PKCbeta signaling pathways.
26437962 study concludes that activating mutations in PIK3CD may cause immunodeficiency in patients with a complex phenotype combining defective B and T cell responses, but are less likely to be discovered in patients where only the humoral arm of the immune response is affected and naive T cell numbers are normal
26286043 Studies indicate that phosphatidylinositol-45-bisphosphate 3-kinase 110 kDa catalytic subunit (PIK3CD p110delta) have been described (N334K, C416R, E525K and E1021K with the majority of cases carrying E1021K) as a cause for primary immunodeficiency.
26270987 HIV-1 Vpr induced upregulation of IL6 involves PI3K/Akt mediated activation of NFKB1 (NF-kappa-B) in astrocytes
26270987 HIV-1 Vpr induced upregulation of IL6 involves PI3K/Akt mediated activation of NFKB1 (NF-kappa-B) in astrocytes
26265781 Combined PI3K/Akt and Hsp90 targeting synergistically suppresses essential functions of alloreactive T cells and increases Tregs.
26251180 work identifies FAK as a target of p110delta PI3K that links RhoA with PTEN and establishes for the first time that PTEN is a substrate of FAK-mediated Tyr phosphorylation
26075907 HIV-1 Vpr induced upregulation of IL6 involves PI3K/Akt mediated activation of NFKB1 (NF-kappa-B) in astrocytes
25632006 Expression of functional S1PR1 is reduced by B cell receptor signaling and increased by inhibition of PIK3CD but not SYK or BTK in chronic lymphocytic leukemia cells.
More...

AA Sequence

MPPGVDCPMEFWTKEENQSVVVDFLLPTGVYLNFPVSRNANLSTIKQLLWHRAQYEPLFHMLSGPEAYVF      1 - 70
TCINQTAEQQELEDEQRRLCDVQPFLPVLRLVAREGDRVKKLINSQISLLIGKGLHEFDSLCDPEVNDFR     71 - 140
AKMCQFCEEAAARRQQLGWEAWLQYSFPLQLEPSAQTWGPGTLRLPNRALLVNVKFEGSEESFTFQVSTK    141 - 210
DVPLALMACALRKKATVFRQPLVEQPEDYTLQVNGRHEYLYGSYPLCQFQYICSCLHSGLTPHLTMVHSS    211 - 280
SILAMRDEQSNPAPQVQKPRAKPPPIPAKKPSSVSLWSLEQPFRIELIQGSKVNADERMKLVVQAGLFHG    281 - 350
NEMLCKTVSSSEVSVCSEPVWKQRLEFDINICDLPRMARLCFALYAVIEKAKKARSTKKKSKKADCPIAW    351 - 420
ANLMLFDYKDQLKTGERCLYMWPSVPDEKGELLNPTGTVRSNPNTDSAAALLICLPEVAPHPVYYPALEK    421 - 490
ILELGRHSECVHVTEEEQLQLREILERRGSGELYEHEKDLVWKLRHEVQEHFPEALARLLLVTKWNKHED    491 - 560
VAQMLYLLCSWPELPVLSALELLDFSFPDCHVGSFAIKSLRKLTDDELFQYLLQLVQVLKYESYLDCELT    561 - 630
KFLLDRALANRKIGHFLFWHLRSEMHVPSVALRFGLILEAYCRGSTHHMKVLMKQGEALSKLKALNDFVK    631 - 700
LSSQKTPKPQTKELMHLCMRQEAYLEALSHLQSPLDPSTLLAEVCVEQCTFMDSKMKPLWIMYSNEEAGS    701 - 770
GGSVGIIFKNGDDLRQDMLTLQMIQLMDVLWKQEGLDLRMTPYGCLPTGDRTGLIEVVLRSDTIANIQLN    771 - 840
KSNMAATAAFNKDALLNWLKSKNPGEALDRAIEEFTLSCAGYCVATYVLGIGDRHSDNIMIRESGQLFHI    841 - 910
DFGHFLGNFKTKFGINRERVPFILTYDFVHVIQQGKTNNSEKFERFRGYCERAYTILRRHGLLFLHLFAL    911 - 980
MRAAGLPELSCSKDIQYLKDSLALGKTEEEALKHFRVKFNEALRESWKTKVNWLAHNVSKDNRQ          981 - 1044
//

Text Mined References (84)

PMID Year Title
26770665 2016 Increased expression of the PI3K catalytic subunit p110? underlies elevated S6 phosphorylation and protein synthesis in an individual with autism from a multiplex family.
26540567 2015 Bone marrow stroma-induced resistance of chronic lymphocytic leukemia cells to arsenic trioxide involves Mcl-1 upregulation and is overcome by inhibiting the PI3K? or PKC? signaling pathways.
26437962 2016 Activating PI3K? mutations in a cohort of 669 patients with primary immunodeficiency.
26286043 2015 Hyper-activated PI3K-? in immunodeficiency.
26265781 2015 Combined PI3K/Akt and Hsp90 targeting synergistically suppresses essential functions of alloreactive T cells and increases Tregs.
26251180 2015 Focal adhesion kinase phosphorylates the phosphatase and tensin homolog deleted on chromosome 10 under the control of p110? phosphoinositide-3 kinase.
25632006 2015 Expression of functional sphingosine-1 phosphate receptor-1 is reduced by B cell receptor signaling and increased by inhibition of PI3 kinase ? but not SYK or BTK in chronic lymphocytic leukemia cells.
25469863 2015 Discovery and in vivo evaluation of (S)-N-(1-(7-fluoro-2-(pyridin-2-yl)quinolin-3-yl)ethyl)-9H-purin-6-amine (AMG319) and related PI3K? inhibitors for inflammation and autoimmune disease.
25352054 2015 Gain of Function Mutations of PIK3CD as a Cause of Primary Sclerosing Cholangitis.
25327288 2014 Selective VPS34 inhibitor blocks autophagy and uncovers a role for NCOA4 in ferritin degradation and iron homeostasis in vivo.
More...