Property Summary

Ligand Count 540
NCBI Gene PubMed Count 98
PubMed Score 709.24
PubTator Score 2885.84

Knowledge Summary

Patent (6,395)

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.0

Expression

  Differential Expression (14)

Disease log2 FC p
cutaneous lupus erythematosus 1.800 1.3e-03
cystic fibrosis 1.245 2.0e-03
gastric carcinoma 1.100 3.1e-02
interstitial cystitis 1.600 1.1e-03
juvenile dermatomyositis -1.262 1.8e-10
lung cancer -2.800 2.9e-06
malignant mesothelioma -1.500 4.6e-07
medulloblastoma, large-cell -1.600 8.6e-04
osteosarcoma -3.801 1.8e-06
ovarian cancer -1.600 3.8e-10
primary Sjogren syndrome 1.700 1.2e-03
subependymal giant cell astrocytoma 1.162 2.0e-02
ulcerative colitis 2.000 1.9e-05
Waldenstrons macroglobulinemia 1.545 1.2e-02

Protein-protein Interaction (1)

Gene RIF (113)

AA Sequence

MPPGVDCPMEFWTKEENQSVVVDFLLPTGVYLNFPVSRNANLSTIKQLLWHRAQYEPLFHMLSGPEAYVF      1 - 70
TCINQTAEQQELEDEQRRLCDVQPFLPVLRLVAREGDRVKKLINSQISLLIGKGLHEFDSLCDPEVNDFR     71 - 140
AKMCQFCEEAAARRQQLGWEAWLQYSFPLQLEPSAQTWGPGTLRLPNRALLVNVKFEGSEESFTFQVSTK    141 - 210
DVPLALMACALRKKATVFRQPLVEQPEDYTLQVNGRHEYLYGSYPLCQFQYICSCLHSGLTPHLTMVHSS    211 - 280
SILAMRDEQSNPAPQVQKPRAKPPPIPAKKPSSVSLWSLEQPFRIELIQGSKVNADERMKLVVQAGLFHG    281 - 350
NEMLCKTVSSSEVSVCSEPVWKQRLEFDINICDLPRMARLCFALYAVIEKAKKARSTKKKSKKADCPIAW    351 - 420
ANLMLFDYKDQLKTGERCLYMWPSVPDEKGELLNPTGTVRSNPNTDSAAALLICLPEVAPHPVYYPALEK    421 - 490
ILELGRHSECVHVTEEEQLQLREILERRGSGELYEHEKDLVWKLRHEVQEHFPEALARLLLVTKWNKHED    491 - 560
VAQMLYLLCSWPELPVLSALELLDFSFPDCHVGSFAIKSLRKLTDDELFQYLLQLVQVLKYESYLDCELT    561 - 630
KFLLDRALANRKIGHFLFWHLRSEMHVPSVALRFGLILEAYCRGSTHHMKVLMKQGEALSKLKALNDFVK    631 - 700
LSSQKTPKPQTKELMHLCMRQEAYLEALSHLQSPLDPSTLLAEVCVEQCTFMDSKMKPLWIMYSNEEAGS    701 - 770
GGSVGIIFKNGDDLRQDMLTLQMIQLMDVLWKQEGLDLRMTPYGCLPTGDRTGLIEVVLRSDTIANIQLN    771 - 840
KSNMAATAAFNKDALLNWLKSKNPGEALDRAIEEFTLSCAGYCVATYVLGIGDRHSDNIMIRESGQLFHI    841 - 910
DFGHFLGNFKTKFGINRERVPFILTYDFVHVIQQGKTNNSEKFERFRGYCERAYTILRRHGLLFLHLFAL    911 - 980
MRAAGLPELSCSKDIQYLKDSLALGKTEEEALKHFRVKFNEALRESWKTKVNWLAHNVSKDNRQ          981 - 1044
//

Text Mined References (102)

PMID Year Title