Property Summary

NCBI Gene PubMed Count 115
Grant Count 240
R01 Count 144
Funding $24,558,915.12
PubMed Score 607.35
PubTator Score 235.13

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession O00327 A2I2N6 A8K645 B5ME11 B7WPG7 D3DQW6 O00313 O00314 O00315 O00316 O00317 Q4G136 Q8IUT4 Q99631 Q99649
Symbols TIC
JAP3
MOP3
BMAL1
PASD3
BMAL1c
bHLHe5

Gene

PDB

4H10  

Gene RIF (91)

PMID Text
27060253 Synchronized cells exhibit an autonomous ultradian mitochondrial respiratory activity which is abrogated by silencing the master clock gene BMAL1.
26915801 decreased expression of Bmal1 is correlated with tumor progression and poor prognosis in pancreatic ductal adenocarcinoma, with potential to be used as a biomarker for diagnosis and prognosis
26850841 when overexpressed, c-MYC is able to repress Per1 transactivation by BMAL1/CLOCK via targeting selective E-box sequences. Importantly, upon serum stimulation, MYC was detected in BMAL1 protein complexes
26753996 Our results indicate that activation of TGF-beta1 promotes the transcriptional induction of BMAL1.
26683776 Bmal1 could directly bind to the p53 gene promoter and thereby transcriptionally activate the downstream tumor suppressor pathway in a p53-dependent manner in pancreatic tumors.
26657859 define a regulatory mechanism that links chondrocyte BMAL1 to the maintenance and repair of cartilage
26562283 Data suggest that cryptochromes mediate periodic binding of Ck2b (casein kinase 2beta) to Bmal1 (aryl hydrocarbon receptor nuclear translocator-like protein) and thus inhibit Bmal1-Ser90 phosphorylation by Ck2a (casein kinase 2alpha). [SYNOPSIS]
26507264 ARNTL and PER1 were associated with PD.
26283580 a 4-locus CSNK1E haplotype encompassing the rs1534891 SNP (Z-score=2.685, permuted p=0.0076) and a 3-locus haplotype in ARNTL (Z-score=3.269, permuted p=0.0011) showed a significant association with Bipolar Disorder
26247999 possible circadian rhythm in full-term placental expression
More...

AA Sequence

MADQRMDISSTISDFMSPGPTDLLSSSLGTSGVDCNRKRKGSSTDYQESMDTDKDDPHGRLEYTEHQGRI      1 - 70
KNAREAHSQIEKRRRDKMNSFIDELASLVPTCNAMSRKLDKLTVLRMAVQHMKTLRGATNPYTEANYKPT     71 - 140
FLSDDELKHLILRAADGFLFVVGCDRGKILFVSESVFKILNYSQNDLIGQSLFDYLHPKDIAKVKEQLSS    141 - 210
SDTAPRERLIDAKTGLPVKTDITPGPSRLCSGARRSFFCRMKCNRPSVKVEDKDFPSTCSKKKADRKSFC    211 - 280
TIHSTGYLKSWPPTKMGLDEDNEPDNEGCNLSCLVAIGRLHSHVVPQPVNGEIRVKSMEYVSRHAIDGKF    281 - 350
VFVDQRATAILAYLPQELLGTSCYEYFHQDDIGHLAECHRQVLQTREKITTNCYKFKIKDGSFITLRSRW    351 - 420
FSFMNPWTKEVEYIVSTNTVVLANVLEGGDPTFPQLTASPHSMDSMLPSGEGGPKRTHPTVPGIPGGTRA    421 - 490
GAGKIGRMIAEEIMEIHRIRGSSPSSCGSSPLNITSTPPPDASSPGGKKILNGGTPDIPSSGLLSGQAQE    491 - 560
NPGYPYSDSSSILGENPHIGIDMIDNDQGSSSPSNDEAAMAVIMSLLEADAGLGGPVDFSDLPWPL        561 - 626
//

Text Mined References (121)

PMID Year Title
27060253 2016 Clock-genes and mitochondrial respiratory activity: Evidence of a reciprocal interplay.
26915801 2016 Decreased circadian component Bmal1 predicts tumor progression and poor prognosis in human pancreatic ductal adenocarcinoma.
26850841 2016 c-MYC targets the central oscillator gene Per1 and is regulated by the circadian clock at the post-transcriptional level.
26753996 2016 Regulation of transforming growth factor-beta1 (TGF-?1)-induced pro-fibrotic activities by circadian clock gene BMAL1.
26683776 2016 The circadian clock gene Bmal1 acts as a potential anti-oncogene in pancreatic cancer by activating the p53 tumor suppressor pathway.
26657859 2016 The chondrocyte clock gene Bmal1 controls cartilage homeostasis and integrity.
26562283 2015 A New Role Discovered for a Well-Known Clock Protein.
26507264 2015 Association of ARNTL and PER1 genes with Parkinson's disease: a case-control study of Han Chinese.
26283580 2015 Identification of circadian gene variants in bipolar disorder in Latino populations.
26247999 2015 Evidence for clock genes circadian rhythms in human full-term placenta.
More...