Property Summary

NCBI Gene PubMed Count 127
PubMed Score 672.89
PubTator Score 235.13

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
adrenocortical carcinoma -1.200 2.4e-04
Astrocytoma, Pilocytic -1.200 4.1e-08
atypical teratoid / rhabdoid tumor -2.000 9.0e-11
group 4 medulloblastoma -1.600 4.3e-06
intraductal papillary-mucinous adenoma (... -1.100 3.4e-02
lung cancer -1.400 3.3e-04
medulloblastoma, large-cell -2.300 2.1e-07
ovarian cancer -1.400 1.1e-10
primitive neuroectodermal tumor -2.000 4.0e-05
subependymal giant cell astrocytoma -1.298 9.7e-03

Protein-protein Interaction (5)

Gene RIF (101)

AA Sequence

MADQRMDISSTISDFMSPGPTDLLSSSLGTSGVDCNRKRKGSSTDYQESMDTDKDDPHGRLEYTEHQGRI      1 - 70
KNAREAHSQIEKRRRDKMNSFIDELASLVPTCNAMSRKLDKLTVLRMAVQHMKTLRGATNPYTEANYKPT     71 - 140
FLSDDELKHLILRAADGFLFVVGCDRGKILFVSESVFKILNYSQNDLIGQSLFDYLHPKDIAKVKEQLSS    141 - 210
SDTAPRERLIDAKTGLPVKTDITPGPSRLCSGARRSFFCRMKCNRPSVKVEDKDFPSTCSKKKADRKSFC    211 - 280
TIHSTGYLKSWPPTKMGLDEDNEPDNEGCNLSCLVAIGRLHSHVVPQPVNGEIRVKSMEYVSRHAIDGKF    281 - 350
VFVDQRATAILAYLPQELLGTSCYEYFHQDDIGHLAECHRQVLQTREKITTNCYKFKIKDGSFITLRSRW    351 - 420
FSFMNPWTKEVEYIVSTNTVVLANVLEGGDPTFPQLTASPHSMDSMLPSGEGGPKRTHPTVPGIPGGTRA    421 - 490
GAGKIGRMIAEEIMEIHRIRGSSPSSCGSSPLNITSTPPPDASSPGGKKILNGGTPDIPSSGLLSGQAQE    491 - 560
NPGYPYSDSSSILGENPHIGIDMIDNDQGSSSPSNDEAAMAVIMSLLEADAGLGGPVDFSDLPWPL        561 - 626
//

Text Mined References (134)

PMID Year Title