Property Summary

NCBI Gene PubMed Count 22
PubMed Score 36.23
PubTator Score 25.04

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
Atopic dermatitis -1.100 1.6e-02
esophageal adenocarcinoma -2.300 2.8e-02
interstitial cystitis -4.300 1.3e-02
psoriasis -3.100 7.7e-03
spina bifida -1.458 3.7e-02
urothelial carcinoma -2.600 4.0e-02

Gene RIF (9)

AA Sequence

MASAAAAEAEKGSPVVVGLLVVGNIIILLSGLSLFAETIWVTADQYRVYPLMGVSGKDDVFAGAWIAIFC      1 - 70
GFSFFMVASFGVGAALCRRRSMVLTYLVLMLIVYIFECASCITSYTHRDYMVSNPSLITKQMLTFYSADT     71 - 140
DQGQELTRLWDRVMIEQECCGTSGPMDWVNFTSAFRAATPEVVFPWPPLCCRRTGNFIPLNEEGCRLGHM    141 - 210
DYLFTKGCFEHIGHAIDSYTWGISWFGFAILMWTLPVMLIAMYFYTML                          211 - 258
//

Text Mined References (22)

PMID Year Title