Property Summary

NCBI Gene PubMed Count 21
Grant Count 30
R01 Count 6
Funding $7,251,852.05
PubMed Score 34.46
PubTator Score 25.04

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
urothelial carcinoma -2.600 0.040
esophageal adenocarcinoma -2.300 0.028
psoriasis -3.100 0.008
Atopic dermatitis -1.100 0.016
interstitial cystitis -6.700 0.000
spina bifida -1.458 0.037

Gene RIF (9)

PMID Text
25701463 Down-regulation of UPK1A suppresses proliferation and enhances apoptosis of bladder transitional cell carcinoma cells.
25197375 expression of UPKIa was a promising predictor for poor outcome of colorectal cancer patients
24698999 Reduced expression of uroplakin 1A is associated with gastric adenocarcinoma.
20978196 Loss of UPK1A is associated with esophageal squamous cell carcinoma.
19577575 The authors show by cryo-electron microscopy that FimH binding to the extracellular domain of UP Ia induces global conformational changes in the entire UP receptor complex, including a coordinated movement of the tightly bundled transmembrane helices.
18051367 HIV-1 Tat downregulates uroplakin 1A in HEK 293T cells
15913809 determined the genomic structure of the uroplakin Ia gene and defined the position of a transcriptional start site
15200408 Observational study of gene-disease association. (HuGE Navigator)
12036448 uroplakin Ia is expressed in urinary bladder transitional cell carcinoma

AA Sequence

MASAAAAEAEKGSPVVVGLLVVGNIIILLSGLSLFAETIWVTADQYRVYPLMGVSGKDDVFAGAWIAIFC      1 - 70
GFSFFMVASFGVGAALCRRRSMVLTYLVLMLIVYIFECASCITSYTHRDYMVSNPSLITKQMLTFYSADT     71 - 140
DQGQELTRLWDRVMIEQECCGTSGPMDWVNFTSAFRAATPEVVFPWPPLCCRRTGNFIPLNEEGCRLGHM    141 - 210
DYLFTKGCFEHIGHAIDSYTWGISWFGFAILMWTLPVMLIAMYFYTML                          211 - 258
//

Text Mined References (21)

PMID Year Title
25701463 2015 Downregulation of UPK1A suppresses proliferation and enhances apoptosis of bladder transitional cell carcinoma cells.
25197375 2014 Decreased expression of uroplakin Ia is associated with colorectal cancer progression and poor survival of patients.
24698999 2014 Reduced expression of uroplakin 1A is associated with the poor prognosis of gastric adenocarcinoma patients.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
20978196 2010 Characterization of a candidate tumor suppressor gene uroplakin 1A in esophageal squamous cell carcinoma.
19577575 2009 Uropathogenic E. coli adhesin-induced host cell receptor conformational changes: implications in transmembrane signaling transduction.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
15913809 2005 Transcriptional control of the human urothelial-specific gene, uroplakin Ia.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15200408 2004 Lack of major involvement of human uroplakin genes in vesicoureteral reflux: implications for disease heterogeneity.
More...