Property Summary

NCBI Gene PubMed Count 10
PubMed Score 48.70
PubTator Score 14.38

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
group 3 medulloblastoma 4104 1.6e-03
Disease Target Count Z-score Confidence
Hydranencephaly 11 3.769 1.9
Porencephaly 20 3.534 1.8
Myelomeningocele 16 3.055 1.5

Expression

  Differential Expression (1)

Disease log2 FC p
group 3 medulloblastoma 1.100 1.6e-03

Gene RIF (4)

AA Sequence

MDLWNWDEASPQEVPPGNKLAGLEGAKLGFCFPDLALQGDTPTATAETCWKGTSSSLASFPQLDWGSALL      1 - 70
HPEVPWGAEPDSQALPWSGDWTDMACTAWDSWSGASQTLGPAPLGPGPIPAAGSEGAAGQNCVPVAGEAT     71 - 140
SWSRAQAAGSNTSWDCSVGPDGDTYWGSGLGGEPRTDCTISWGGPAGPDCTTSWNPGLHAGGTTSLKRYQ    141 - 210
SSALTVCSEPSPQSDRASLARCPKTNHRGPIQLWQFLLELLHDGARSSCIRWTGNSREFQLCDPKEVARL    211 - 280
WGERKRKPGMNYEKLSRGLRYYYRRDIVRKSGGRKYTYRFGGRVPSLAYPDCAGGGRGAETQ            281 - 342
//

Text Mined References (11)

PMID Year Title