Property Summary

NCBI Gene PubMed Count 8
Grant Count 35
R01 Count 28
Funding $3,926,071.89
PubMed Score 42.31
PubTator Score 14.38

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
group 3 medulloblastoma 1.100 0.002

Gene RIF (2)

PMID Text
25540418 ets variant 2 (ETV2) alone directly converts primary human adult skin fibroblasts into functional vascular endothelial cells.
18270322 identify human Etv2/ER71 and mouse ER71 proteins as functional orthologs of Etsrp

AA Sequence

MDLWNWDEASPQEVPPGNKLAGLEGAKLGFCFPDLALQGDTPTATAETCWKGTSSSLASFPQLDWGSALL      1 - 70
HPEVPWGAEPDSQALPWSGDWTDMACTAWDSWSGASQTLGPAPLGPGPIPAAGSEGAAGQNCVPVAGEAT     71 - 140
SWSRAQAAGSNTSWDCSVGPDGDTYWGSGLGGEPRTDCTISWGGPAGPDCTTSWNPGLHAGGTTSLKRYQ    141 - 210
SSALTVCSEPSPQSDRASLARCPKTNHRGPIQLWQFLLELLHDGARSSCIRWTGNSREFQLCDPKEVARL    211 - 280
WGERKRKPGMNYEKLSRGLRYYYRRDIVRKSGGRKYTYRFGGRVPSLAYPDCAGGGRGAETQ            281 - 342
//

Text Mined References (9)

PMID Year Title
25540418 2015 ETS transcription factor ETV2 directly converts human fibroblasts into functional endothelial cells.
18270322 2008 Interplay among Etsrp/ER71, Scl, and Alk8 signaling controls endothelial and myeloid cell formation.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12087183 2002 Functional analysis of the transcription factor ER71 and its activation of the matrix metalloproteinase-1 promoter.
1340465 1992 Specificities of protein-protein and protein-DNA interaction of GABP alpha and two newly defined ets-related proteins.