Property Summary

NCBI Gene PubMed Count 61
Grant Count 174
R01 Count 137
Funding $16,778,222.02
PubMed Score 175.08
PubTator Score 90.95

Knowledge Summary

Patent (13,132)

Expression

  Differential Expression (18)

Synonym

Accession O00311 D3DT31 O00558 Q5T5U5 CDC7-related kinase
Symbols Hsk1
CDC7L1
HsCDC7
huCDC7

Gene

PDB

4F99   4F9A   4F9B   4F9C  

Gene RIF (39)

PMID Text
26383992 The presence of the index SNP rs1192415 (TGFBR3-CDC7) was associated with visual field progression in POAG (primary open-angle glaucoma) patients.
26208856 Our data show that Cdc7 is highly expressed in colorectal cancer
25258324 The state of DUE-B phosphorylation is maintained by the equilibrium between Cdc7-dependent phosphorylation and PP2A-dependent dephosphorylation.
25255219 MiR-630 promoted apoptosis by downregulation of CDC7.
23716994 huCdc7 may play an important role in the development and progression of colorectal cancer.
23684929 Cdcy is universally up-regulated in oral squamous cell carcinoma is an independent prognostic marker, contributing to resistance to DNA damaging agents.
23598722 The interaction between Claspin and Cdc7 is not dependent on Cdc7 kinase activity, but Claspin interaction with the DNA helicase subunit Mcm2 is lost upon Cdc7 inhibition.
23066029 Cdc7 phosphorylates and interacts with Tob to inhibit the Cul4-DDB1(Cdt2)-dependent Tob degradation.
22806309 Significantly higher levels of apoptosis were detected in siCDC7-transfected cells.
22574151 cell death process induced by Cdc7 depletion
More...

AA Sequence

MEASLGIQMDEPMAFSPQRDRFQAEGSLKKNEQNFKLAGVKKDIEKLYEAVPQLSNVFKIEDKIGEGTFS      1 - 70
SVYLATAQLQVGPEEKIALKHLIPTSHPIRIAAELQCLTVAGGQDNVMGVKYCFRKNDHVVIAMPYLEHE     71 - 140
SFLDILNSLSFQEVREYMLNLFKALKRIHQFGIVHRDVKPSNFLYNRRLKKYALVDFGLAQGTHDTKIEL    141 - 210
LKFVQSEAQQERCSQNKSHIITGNKIPLSGPVPKELDQQSTTKASVKRPYTNAQIQIKQGKDGKEGSVGL    211 - 280
SVQRSVFGERNFNIHSSISHESPAVKLMKQSKTVDVLSRKLATKKKAISTKVMNSAVMRKTASSCPASLT    281 - 350
CDCYATDKVCSICLSRRQQVAPRAGTPGFRAPEVLTKCPNQTTAIDMWSAGVIFLSLLSGRYPFYKASDD    351 - 420
LTALAQIMTIRGSRETIQAAKTFGKSILCSKEVPAQDLRKLCERLRGMDSSTPKLTSDIQGHASHQPAIS    421 - 490
EKTDHKASCLVQTPPGQYSGNSFKKGDSNSCEHCFDEYNTNLEGWNEVPDEAYDLLDKLLDLNPASRITA    491 - 560
EEALLHPFFKDMSL                                                            561 - 574
//

Text Mined References (65)

PMID Year Title
26383992 2015 A Genetic Variant in TGFBR3-CDC7 Is Associated with Visual Field Progression in Primary Open-Angle Glaucoma Patients from Singapore.
26208856 2015 Cdc7 overexpression is an independent prognostic marker and a potential therapeutic target in colorectal cancer.
25258324 2014 Protein phosphatase 2A and Cdc7 kinase regulate the DNA unwinding element-binding protein in replication initiation.
25255219 2014 MiR-630 inhibits proliferation by targeting CDC7 kinase, but maintains the apoptotic balance by targeting multiple modulators in human lung cancer A549 cells.
25241763 2014 Meta-analysis of genome-wide association studies identifies novel loci that influence cupping and the glaucomatous process.
24299456 2014 Interaction of human minichromosome maintenance protein-binding protein with minichromosome maintenance 2-7.
23716994 2013 Expression of huCdc7 in colorectal cancer.
23684929 2013 Increased Cdc7 expression is a marker of oral squamous cell carcinoma and overexpression of Cdc7 contributes to the resistance to DNA-damaging agents.
23598722 2013 Cdc7-dependent and -independent phosphorylation of Claspin in the induction of the DNA replication checkpoint.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
More...