Property Summary

NCBI Gene PubMed Count 44
PubMed Score 38.97
PubTator Score 27.97

Knowledge Summary


No data available


  Disease Sources (2)

Disease Target Count P-value
ovarian cancer 8492 4.67680517042517E-11
psoriasis 6685 1.68995776711322E-4
pilocytic astrocytoma 3086 8.95731615802172E-4
lung cancer 4473 0.00199271900280948
COPD 116 0.00572928174822793
oligodendroglioma 2849 0.0206477597370062


  Differential Expression (6)

Disease log2 FC p
oligodendroglioma 1.200 0.021
psoriasis 1.700 0.000
lung cancer -1.100 0.002
pilocytic astrocytoma 1.200 0.001
COPD -1.200 0.006
ovarian cancer -1.700 0.000


Accession O00308 A6NEP1 B2R706 B4DTL5 F5H213 H3BRF3 I3RSG8 Q6ZTQ5 Q96CZ2 Q9BWN6
Symbols AIP2


PANTHER Protein Class (2)



  Ortholog (10)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid

 GWAS Trait (1)

Gene RIF (15)

25356737 majority of ovarian carcinomas harbored homozygous or heterozygous deletions in WWP2 locus, and there was an inverse correlation in the expression levels between WWP2 and Notch3 in ovarian carcinomas
25266661 Data provide evidence that the stability of Paip1 can be regulated by ubiquitin-mediated degradation, thus highlighting the importance of WWP2 as a suppressor of translation.
25071155 Results identify WWP2 as a novel p73-associated protein that ubiquitinates and degrades p73.
24365151 Wwp2 acts as a ubiquitin ligase of SRG3.
23938591 WWP2-N is downregulated in stage IIIC melanoma and up-regulated in stage II/III prostate cancer, and WWP2-FL and WWP2-C overexpression is associated with early-stage breast cancer.
23651516 Koala retrovirus Gag PPPY L-domain interacts with the WW domain(s) of WWP2 and progeny virions are released from cells by utilizing the multivesicular body sorting pathway.
21532586 WWP2 controls cellular apoptosis and is required for tumorigenicity of cells
21258410 Data show that the WWP2-N isoform interacts with Smad2 and Smad3, whereas WWP2-C interacts only with Smad7.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19651900 AIP2 regulates activation-induced T-cell death by suppressing EGR2-mediated FasL expression via the ubiquitin pathway

AA Sequence

RLDLPPYKSYEQLREKLLYAIEETEGFGQE                                            841 - 870

Text Mined References (50)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25356737 2014 Notch3 interactome analysis identified WWP2 as a negative regulator of Notch3 signaling in ovarian cancer.
25266661 2014 Paip1, an effective stimulator of translation initiation, is targeted by WWP2 for ubiquitination and degradation.
25231870 2014 Parent-of-origin-specific allelic associations among 106 genomic loci for age at menarche.
25071155 2014 WWP2-WWP1 ubiquitin ligase complex coordinated by PPM1G maintains the balance between cellular p73 and ?Np73 levels.
24365151 2014 Wwp2 targets SRG3, a scaffold protein of the SWI/SNF-like BAF complex, for ubiquitination and degradation.
24105792 2014 Protein microarray characterization of the S-nitrosoproteome.
23938591 2013 Novel WWP2 ubiquitin ligase isoforms as potential prognostic markers and molecular targets in cancer.
23651516 2013 Identification of cellular factors required for the budding of koala retrovirus.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.