Property Summary

NCBI Gene PubMed Count 54
PubMed Score 42.99
PubTator Score 27.97

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (6)

Disease log2 FC p
Astrocytoma, Pilocytic 1.200 9.7e-04
COPD -1.200 5.7e-03
lung cancer -1.100 2.0e-03
oligodendroglioma 1.200 2.1e-02
ovarian cancer -1.700 4.7e-11
psoriasis 1.700 1.7e-04

Protein-protein Interaction (7)

Gene RIF (20)

AA Sequence

MASASSSRAGVALPFEKSQLTLKVVSAKPKVHNRQPRINSYVEVAVDGLPSETKKTGKRIGSSELLWNEI      1 - 70
IILNVTAQSHLDLKVWSCHTLRNELLGTASVNLSNVLKNNGGKMENMQLTLNLQTENKGSVVSGGELTIF     71 - 140
LDGPTVDLGNVPNGSALTDGSQLPSRDSSGTAVAPENRHQPPSTNCFGGRSRTHRHSGASARTTPATGEQ    141 - 210
SPGARSRHRQPVKNSGHSGLANGTVNDEPTTATDPEEPSVVGVTSPPAAPLSVTPNPNTTSLPAPATPAE    211 - 280
GEEPSTSGTQQLPAAAQAPDALPAGWEQRELPNGRVYYVDHNTKTTTWERPLPPGWEKRTDPRGRFYYVD    281 - 350
HNTRTTTWQRPTAEYVRNYEQWQSQRNQLQGAMQHFSQRFLYQSSSASTDHDPLGPLPPGWEKRQDNGRV    351 - 420
YYVNHNTRTTQWEDPRTQGMIQEPALPPGWEMKYTSEGVRYFVDHNTRTTTFKDPRPGFESGTKQGSPGA    421 - 490
YDRSFRWKYHQFRFLCHSNALPSHVKISVSRQTLFEDSFQQIMNMKPYDLRRRLYIIMRGEEGLDYGGIA    491 - 560
REWFFLLSHEVLNPMYCLFEYAGKNNYCLQINPASSINPDHLTYFRFIGRFIAMALYHGKFIDTGFTLPF    561 - 630
YKRMLNKRPTLKDLESIDPEFYNSIVWIKENNLEECGLELYFIQDMEILGKVTTHELKEGGESIRVTEEN    631 - 700
KEEYIMLLTDWRFTRGVEEQTKAFLDGFNEVAPLEWLRYFDEKELELMLCGMQEIDMSDWQKSTIYRHYT    701 - 770
KNSKQIQWFWQVVKEMDNEKRIRLLQFVTGTCRLPVGGFAELIGSNGPQKFCIDKVGKETWLPRSHTCFN    771 - 840
RLDLPPYKSYEQLREKLLYAIEETEGFGQE                                            841 - 870
//

Text Mined References (62)

PMID Year Title