Property Summary

NCBI Gene PubMed Count 43
Grant Count 8
R01 Count 4
Funding $366,585.83
PubMed Score 24.48
PubTator Score 20.99

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
Rheumatoid Arthritis 1.200 0.038
oligodendroglioma 1.100 0.000
group 3 medulloblastoma 1.400 0.027
type II diabetes mellitus and post-ische... -1.100 0.040
primitive neuroectodermal tumor 1.200 0.001
diabetes mellitus -1.300 0.001
Breast cancer -1.500 0.000
invasive ductal carcinoma -1.400 0.001
ovarian cancer -2.300 0.000

Gene RIF (12)

PMID Text
26497985 eIF3f/alpha adrenergic receptor interaction
24732644 eIF3f may play an important role in recurrence.
24678890 Decreased expression of eukaryotic initiation factor 3f is associated with gastric cancer.
22457825 findings established a new mechanism of rRNA decay regulation mediated by hnRNP K/eIF3f and suggest that the tumor suppressive function of eIF3f may link to impaired rRNA degradation and translation
22190034 HIV-1 PR is identified to have a physical interaction with eukaryotic translation initiation factor 3, subunit F (EIF3F) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
22190034 HIV-1 PR is identified to have a physical interaction with eukaryotic translation initiation factor 3, subunit F (EIF3F) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
21124883 catalytically inactive forms of eIF3f as well as shRNAs targeting eIF3f repress Notch activation in a coculture assay, showing that eIF3f is a new positive regulator of the Notch pathway
19854136 eIF3f mediates restriction of HIV-1 expression through a set of factors that includes eIF3f, the SR protein 9G8, and the cyclin-dependent kinase 11 (CDK11).
19245811 eIF3f may inhibit translation by increasing the binding to the eIF3 complex during apoptosis.
19237569 eIF3f specifically interferes with the 3' end processing of HIV-1 mRNAs
More...

AA Sequence

MATPAVPVSAPPATPTPVPAAAPASVPAPTPAPAAAPVPAAAPASSSDPAAAAAATAAPGQTPASAQAPA      1 - 70
QTPAPALPGPALPGPFPGGRVVRLHPVILASIVDSYERRNEGAARVIGTLLGTVDKHSVEVTNCFSVPHN     71 - 140
ESEDEVAVDMEFAKNMYELHKKVSPNELILGWYATGHDITEHSVLIHEYYSREAPNPIHLTVDTSLQNGR    141 - 210
MSIKAYVSTLMGVPGRTMGVMFTPLTVKYAYYDTERIGVDLIMKTCFSPNRVIGLSSDLQQVGGASARIQ    211 - 280
DALSTVLQYAEDVLSGKVSADNTVGRFLMSLVNQVPKIVPDDFETMLNSNINDLLMVTYLANLTQSQIAL    281 - 350
NEKLVNL                                                                   351 - 357
//

Text Mined References (58)

PMID Year Title
27462815 2016 eIF3d is an mRNA cap-binding protein that is required for specialized translation initiation.
26497985 2015 The eukaryotic translation initiation factor 3f (eIF3f) interacts physically with the alpha 1B-adrenergic receptor and stimulates adrenoceptor activity.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25849773 2015 eIF3 targets cell-proliferation messenger RNAs for translational activation or repression.
25416956 2014 A proteome-scale map of the human interactome network.
24732644 2014 Expression of eukaryotic initiation factor 3f is associated with prognosis in gastric carcinomas.
24678890 2014 Decreased expression of eukaryotic initiation factor 3f is an adverse prognostic factor for stage I-III gastric cancer.
24396066 2014 Control of Paip1-eukayrotic translation initiation factor 3 interaction by amino acids through S6 kinase.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24243016 2013 Gle1 functions during mRNA export in an oligomeric complex that is altered in human disease.
More...