Property Summary

NCBI Gene PubMed Count 46
PubMed Score 25.26
PubTator Score 20.99

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
Breast cancer -1.500 5.3e-12
diabetes mellitus -1.300 1.1e-03
group 3 medulloblastoma 1.400 2.7e-02
invasive ductal carcinoma -1.400 1.3e-03
oligodendroglioma 1.100 3.2e-09
ovarian cancer -2.300 2.2e-07
primitive neuroectodermal tumor 1.200 1.1e-03
Rheumatoid arthritis 1.200 3.8e-02
type II diabetes mellitus and post-ische... -1.100 4.0e-02

Gene RIF (12)

AA Sequence

MATPAVPVSAPPATPTPVPAAAPASVPAPTPAPAAAPVPAAAPASSSDPAAAAAATAAPGQTPASAQAPA      1 - 70
QTPAPALPGPALPGPFPGGRVVRLHPVILASIVDSYERRNEGAARVIGTLLGTVDKHSVEVTNCFSVPHN     71 - 140
ESEDEVAVDMEFAKNMYELHKKVSPNELILGWYATGHDITEHSVLIHEYYSREAPNPIHLTVDTSLQNGR    141 - 210
MSIKAYVSTLMGVPGRTMGVMFTPLTVKYAYYDTERIGVDLIMKTCFSPNRVIGLSSDLQQVGGASARIQ    211 - 280
DALSTVLQYAEDVLSGKVSADNTVGRFLMSLVNQVPKIVPDDFETMLNSNINDLLMVTYLANLTQSQIAL    281 - 350
NEKLVNL                                                                   351 - 357
//

Text Mined References (61)

PMID Year Title