Property Summary

NCBI Gene PubMed Count 82
Grant Count 88
R01 Count 50
Funding $8,726,395.17
PubMed Score 770.20
PubTator Score 124.15

Knowledge Summary

Patent (3,572)

Expression

  Differential Expression (1)

Disease log2 FC p
diabetes mellitus -1.300 0.021

Synonym

Accession O00299 Q15089 Q502X1
Symbols G6
NCC27

Gene

PDB

1K0M   1K0N   1K0O   1RK4   3O3T   3P8W   3P90   3QR6   3SWL   3TGZ   3UVH   4IQA   4JZQ   4K0G   4K0N  

Gene RIF (53)

PMID Text
26429879 Extracellular vesicle-mediated transfer of CLIC1 protein is a novel mechanism for the regulation of glioblastoma growth.
25920608 CLIC1 acts as a putative oncogene in pancreatic cancer.
25582317 CLIC1 may be a potential sensitive and specific molecular biomarker for early diagnose for serous epithelial ovarian cancers metastasis.
25546839 CLIC1 and CLIC4 are overexpressed in specific tumor types or their corresponding stroma and change localization and function from hydrophilic cytosolic to integral transmembrane proteins. (Review)
25279971 Results indicate that CLIC1 could regulate prostate cancer cell proliferation and migration by regulating the(MAPK)/ERK pathway.
25227665 The expression of CLIC1 is closely related to the progression of gall bladder cancer and may be used as an effective marker for predicting the prognosis of this disease.
25209805 Data show that glutamate 85 and glutamate 228 are pH-sensor residues of chloride intracellular channel protein CLIC1 and contribute to the pH-response stability in different ways.
25205595 Results indicate that CLIC1 is an important contributor to tumor invasion, metastasis, and angiogenesis.
24989236 It participates in migration and invasion of hepatocellular carcinoma by targeting maspin.
24661138 Data indicate the chloride channel protein CLIC1 as the most penetrant receptor.
More...

AA Sequence

MAEEQPQVELFVKAGSDGAKIGNCPFSQRLFMVLWLKGVTFNVTTVDTKRRTETVQKLCPGGQLPFLLYG      1 - 70
TEVHTDTNKIEEFLEAVLCPPRYPKLAALNPESNTAGLDIFAKFSAYIKNSNPALNDNLEKGLLKALKVL     71 - 140
DNYLTSPLPEEVDETSAEDEGVSQRKFLDGNELTLADCNLLPKLHIVQVVCKKYRGFTIPEAFRGVHRYL    141 - 210
SNAYAREEFASTCPDDEEIELAYEQVAKALK                                           211 - 241
//

Text Mined References (91)

PMID Year Title
26429879 2015 Extracellular vesicle-mediated transfer of CLIC1 protein is a novel mechanism for the regulation of glioblastoma growth.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25920608 2015 Chloride intracellular channel 1 (CLIC1) is activated and functions as an oncogene in pancreatic cancer.
25582317 2015 CLIC1 a novel biomarker of intraperitoneal metastasis in serous epithelial ovarian cancer.
25546839 2015 Chloride channels in cancer: Focus on chloride intracellular channel 1 and 4 (CLIC1 AND CLIC4) proteins in tumor development and as novel therapeutic targets.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25279971 2014 Chloride intracellular channel 1 regulates prostate cancer cell proliferation and migration through the MAPK/ERK pathway.
25227665 2015 CLIC1 overexpression is associated with poor prognosis in gallbladder cancer.
25209805 2015 Glutamate 85 and glutamate 228 contribute to the pH-response of the soluble form of chloride intracellular channel 1.
25205595 2015 Relocation of CLIC1 promotes tumor cell invasion and colonization of fibrin.
More...