Property Summary

NCBI Gene PubMed Count 27
PubMed Score 98.43
PubTator Score 35.23

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (7)

Disease log2 FC p
adult high grade glioma 1.200 4.0e-03
diabetes mellitus 1.600 1.1e-03
glioblastoma 1.500 1.0e-02
group 3 medulloblastoma 1.500 1.2e-02
ovarian cancer -1.100 1.0e-02
posterior fossa group B ependymoma 1.300 4.5e-06
psoriasis -1.700 1.4e-25

Protein-protein Interaction (1)

Gene RIF (12)

AA Sequence

MWPLWLCWALWVLPLAGPGAALTEEQLLGSLLRQLQLSEVPVLDRADMEKLVIPAHVRAQYVVLLRRSHG      1 - 70
DRSRGKRFSQSFREVAGRFLASEASTHLLVFGMEQRLPPNSELVQAVLRLFQEPVPKAALHRHGRLSPRS     71 - 140
AQARVTVEWLRVRDDGSNRTSLIDSRLVSVHESGWKAFDVTEAVNFWQQLSRPRQPLLLQVSVQREHLGP    141 - 210
LASGAHKLVRFASQGAPAGLGEPQLELHTLDLRDYGAQGDCDPEAPMTEGTRCCRQEMYIDLQGMKWAKN    211 - 280
WVLEPPGFLAYECVGTCQQPPEALAFNWPFLGPRQCIASETASLPMIVSIKEGGRTRPQVVSLPNMRVQK    281 - 350
CSCASDGALVPRRLQP                                                          351 - 366
//

Text Mined References (29)

PMID Year Title