Property Summary

NCBI Gene PubMed Count 25
Grant Count 4
Funding $753,092.67
PubMed Score 90.27
PubTator Score 35.23

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
glioblastoma 1.500 0.010
diabetes mellitus 1.600 0.001
pediatric high grade glioma 1.300 0.003
group 3 medulloblastoma 1.500 0.012
posterior fossa group B ependymoma 1.300 0.000
ovarian cancer -1.100 0.010
psoriasis -1.700 0.000

Synonym

Accession O00292 B3KNH4 B4E332 E9PDM4 O75611 Q5TE89 Q8NBQ9
Symbols EBAF
LEFTA
TGFB4
LEFTYA

Gene

PANTHER Protein Class (2)

Gene RIF (10)

PMID Text
22469982 Lefty A may account for the tumor suppressive activity of human adult stem cells.
21401636 Findings show that during embryonic development, EBAF/LEFTY B plays important roles in decidualization and embryo implantation.
21266536 Findings suggest that Lefty2 is negatively modulated by miR-302s in hESCs, which plays an important role in maintaining the balance between pluripotency and germ layer specification.
20734064 Observational study of gene-disease association. (HuGE Navigator)
20634891 Observational study of gene-disease association. (HuGE Navigator)
17038673 LEFTY proteins, which are known to play a major role during mouse gastrulation, are transiently expressed during human embryonic stem cell differentiation.
15536155 Addition of recombinant LEFTY-A to explants induced MMP-9 in most samples, a response prevented by ovarian steroids.
15308665 nodal and the inhibitors of Nodal signaling, lefty-A and lefty-B, are down-regulated very early upon differentiation of human embryonic stem cells
12215426 may provide a crucial signal for endometrial breakdown and bleeding by triggering expression of several matrix metalloproteinases
9230066 findings show that the TGFB4 (ebaf) mRNA has distinct tumor specific expression

AA Sequence

MWPLWLCWALWVLPLAGPGAALTEEQLLGSLLRQLQLSEVPVLDRADMEKLVIPAHVRAQYVVLLRRSHG      1 - 70
DRSRGKRFSQSFREVAGRFLASEASTHLLVFGMEQRLPPNSELVQAVLRLFQEPVPKAALHRHGRLSPRS     71 - 140
AQARVTVEWLRVRDDGSNRTSLIDSRLVSVHESGWKAFDVTEAVNFWQQLSRPRQPLLLQVSVQREHLGP    141 - 210
LASGAHKLVRFASQGAPAGLGEPQLELHTLDLRDYGAQGDCDPEAPMTEGTRCCRQEMYIDLQGMKWAKN    211 - 280
WVLEPPGFLAYECVGTCQQPPEALAFNWPFLGPRQCIASETASLPMIVSIKEGGRTRPQVVSLPNMRVQK    281 - 350
CSCASDGALVPRRLQP                                                          351 - 366
//

Text Mined References (27)

PMID Year Title
27404958 2016 LeftyA decreases Actin Polymerization and Stiffness in Human Endometrial Cancer Cells.
25838200 2015 LeftyA sensitive cytosolic pH regulation and glycolytic flux in Ishikawa human endometrial cancer cells.
23658023 2013 Comparative proteomic analysis of supportive and unsupportive extracellular matrix substrates for human embryonic stem cell maintenance.
22469982 2013 Role of Lefty in the anti tumor activity of human adult liver stem cells.
21401636 2011 Isolation, characterization, and function of EBAF/LEFTY B: role in infertility.
21266536 2011 The Nodal inhibitor Lefty is negatively modulated by the microRNA miR-302 in human embryonic stem cells.
20734064 2010 A large-scale candidate gene association study of age at menarche and age at natural menopause.
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
17038673 2007 Molecular analysis of LEFTY-expressing cells in early human embryoid bodies.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
More...