Property Summary

NCBI Gene PubMed Count 20
PubMed Score 15.83
PubTator Score 23.84

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Bare lymphocyte syndrome 2 4 0.0 0.0
Disease Target Count Z-score Confidence
MHC class II deficiency 6 0.0 5.0
Disease Target Count Z-score Confidence
Severe combined immunodeficiency 51 5.064 2.5
Disease Target Count
Bare Lymphocyte Syndrome, Type 2 4

Expression

  Differential Expression (8)

Disease log2 FC p
adult high grade glioma -1.300 3.8e-04
group 3 medulloblastoma 1.100 1.4e-02
invasive ductal carcinoma -1.100 9.2e-03
osteosarcoma -2.176 6.5e-05
ovarian cancer -1.100 2.8e-03
posterior fossa group A ependymoma 1.100 5.8e-04
primitive neuroectodermal tumor 1.100 3.3e-04
subependymal giant cell astrocytoma -1.293 1.7e-02

Gene RIF (8)

AA Sequence

MEAQGVAEGAGPGAASGVPHPAALAPAAAPTLAPASVAAAASQFTLLVMQPCAGQDEAAAPGGSVGAGKP      1 - 70
VRYLCEGAGDGEEEAGEDEADLLDTSDPPGGGESAASLEDLEDEETHSGGEGSSGGARRRGSGGGSMSKT     71 - 140
CTYEGCSETTSQVAKQRKPWMCKKHRNKMYKDKYKKKKSDQALNCGGTASTGSAGNVKLEESADNILSIV    141 - 210
KQRTGSFGDRPARPTLLEQVLNQKRLSLLRSPEVVQFLQKQQQLLNQQVLEQRQQQFPGTSM            211 - 272
//

Text Mined References (24)

PMID Year Title