Property Summary

NCBI Gene PubMed Count 56
PubMed Score 314.76
PubTator Score 131.80

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (3)

Disease log2 FC p
lung cancer 1.200 9.7e-03
osteosarcoma 1.340 2.6e-04
Pick disease 1.100 2.5e-06

Protein-protein Interaction (2)

Gene RIF (24)

AA Sequence

MEVTGDAGVPESGEIRTLKPCLLRRNYSREQHGVAASCLEDLRSKACDILAIDKSLTPVTLVLAEDGTIV      1 - 70
DDDDYFLCLPSNTKFVALASNEKWAYNNSDGGTAWISQESFDVDETDSGAGLKWKNVARQLKEDLSSIIL     71 - 140
LSEEDLQMLVDAPCSDLAQELRQSCATVQRLQHTLQQVLDQREEVRQSKQLLQLYLQALEKEGSLLSKQE    141 - 210
ESKAAFGEEVDAVDTGISRETSSDVALASHILTALREKQAPELSLSSQDLELVTKEDPKALAVALNWDIK    211 - 280
KTETVQEACERELALRLQQTQSLHSLRSISASKASPPGDLQNPKRARQDPT                       281 - 331
//

Text Mined References (68)

PMID Year Title