Property Summary

NCBI Gene PubMed Count 5
Grant Count 3
Funding $117,185
PubMed Score 14.49
PubTator Score 6.70

Knowledge Summary

Patent (3,681)

TINX Plot

  Disease Relevance (2)

Synonym

Accession O00270 B0M0K2 Q4VBL3 Q9NQ20 12-(S)-HETE receptor
Symbols HETER
HETER1
12-HETER

Gene

PANTHER Protein Class (2)

  TechDev Info (1)

Gene RIF (1)

PMID Text
21712392 12-HETER represents the first identified high affinity receptor for the 12-(S)-HETE hydroxyl fatty acids.

AA Sequence

MPFPNCSAPSTVVATAVGVLLGLECGLGLLGNAVALWTFLFRVRVWKPYAVYLLNLALADLLLAACLPFL      1 - 70
AAFYLSLQAWHLGRVGCWALHFLLDLSRSVGMAFLAAVALDRYLRVVHPRLKVNLLSPQAALGVSGLVWL     71 - 140
LMVALTCPGLLISEAAQNSTRCHSFYSRADGSFSIIWQEALSCLQFVLPFGLIVFCNAGIIRALQKRLRE    141 - 210
PEKQPKLQRAQALVTLVVVLFALCFLPCFLARVLMHIFQNLGSCRALCAVAHTSDVTGSLTYLHSVLNPV    211 - 280
VYCFSSPTFRSSYRRVFHTLRGKGQAAEPPDFNPRDSYS                                   281 - 319
//

Text Mined References (6)

PMID Year Title
24133439 2013 Genome-wide association study of autistic-like traits in a general population study of young adults.
21712392 2011 Identification of the orphan G protein-coupled receptor GPR31 as a receptor for 12-(S)-hydroxyeicosatetraenoic acid.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9205127 1997 Isolation and chromosomal localization of GPR31, a human gene encoding a putative G protein-coupled receptor.