Property Summary

NCBI Gene PubMed Count 64
PubMed Score 76.67
PubTator Score 40.01

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
ovarian cancer 8492 5.50951460855524E-8
diabetes mellitus 1663 0.00218207657350365
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Wolf-Hirschhorn syndrome 32 3.395 1.7

Expression

  Differential Expression (2)

Disease log2 FC p
diabetes mellitus -1.100 0.002
ovarian cancer 1.100 0.000

Synonym

Accession O00267 O43279 Q59G52 Q99639 hSPT5
Symbols SPT5
SPT5H
Tat-CT1

Gene

PDB

3H7H   4L1U   2DO3   2E6Z   2E70  

  Ortholog (16)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA EggNOG Inparanoid
C. elegans OMA EggNOG Inparanoid
Fruitfly OMA Inparanoid
S.cerevisiae OMA EggNOG Inparanoid

Gene RIF (25)

PMID Text
26903558 A transcription-independent effect of tumor necrosis factor alpha on RNA splicing, mediated by Spt5.
26418880 SPT5 contributes to the up-regulation of hTERT expression and colonic tumor development.
25731772 SPT5 associates with the HIV-1 Tat cofactor Tat-SF1 and the RNA polymerase II holoenzyme and stimulates Tat-mediated transcriptional activation of the HIV-1 LTR promoter
24101474 Data indicate that the Plus3 domain of the Rtf1 subunit mediates Paf1C recruitment to genes by binding a repeating domain within the phosphorylated elongation factor Spt5.
23518577 SPT5 associates with the HIV-1 Tat cofactor Tat-SF1 and the RNA polymerase II holoenzyme and stimulates Tat-mediated transcriptional activation of the HIV-1 LTR promoter
23041311 DSIF Is Selectively Required for mRNA Splicing and Export of NF-kappaB Target Genes.
22422068 SPT5 associates with the HIV-1 Tat cofactor Tat-SF1 and the RNA polymerase II holoenzyme and stimulates Tat-mediated transcriptional activation of the HIV-1 LTR promoter
22355797 SPT5 associates with the HIV-1 Tat cofactor Tat-SF1 and the RNA polymerase II holoenzyme and stimulates Tat-mediated transcriptional activation of the HIV-1 LTR promoter
20471948 SPT5 associates with the HIV-1 Tat cofactor Tat-SF1 and the RNA polymerase II holoenzyme and stimulates Tat-mediated transcriptional activation of the HIV-1 LTR promoter
19952111 he Paf1 complex (Paf1C) and Tat-SF1, two factors implicated previously in elongation control, collaborate with DSIF to facilitate efficient elongation
More...

AA Sequence

MSDSEDSNFSEEEDSERSSDGEEAEVDEERRSAAGSEKEEEPEDEEEEEEEEEYDEEEEEEDDDRPPKKP      1 - 70
RHGGFILDEADVDDEYEDEDQWEDGAEDILEKEEIEASNIDNVVLDEDRSGARRLQNLWRDQREEELGEY     71 - 140
YMKKYAKSSVGETVYGGSDELSDDITQQQLLPGVKDPNLWTVKCKIGEERATAISLMRKFIAYQFTDTPL    141 - 210
QIKSVVAPEHVKGYIYVEAYKQTHVKQAIEGVGNLRLGYWNQQMVPIKEMTDVLKVVKEVANLKPKSWVR    211 - 280
LKRGIYKDDIAQVDYVEPSQNTISLKMIPRIDYDRIKARMSLKDWFAKRKKFKRPPQRLFDAEKIRSLGG    281 - 350
DVASDGDFLIFEGNRYSRKGFLFKSFAMSAVITEGVKPTLSELEKFEDQPEGIDLEVVTESTGKEREHNF    351 - 420
QPGDNVEVCEGELINLQGKILSVDGNKITIMPKHEDLKDMLEFPAQELRKYFKMGDHVKVIAGRFEGDTG    421 - 490
LIVRVEENFVILFSDLTMHELKVLPRDLQLCSETASGVDVGGQHEWGELVQLDPQTVGVIVRLERETFQV    491 - 560
LNMYGKVVTVRHQAVTRKKDNRFAVALDSEQNNIHVKDIVKVIDGPHSGREGEIRHLFRSFAFLHCKKLV    561 - 630
ENGGMFVCKTRHLVLAGGSKPRDVTNFTVGGFAPMSPRISSPMHPSAGGQRGGFGSPGGGSGGMSRGRGR    631 - 700
RDNELIGQTVRISQGPYKGYIGVVKDATESTARVELHSTCQTISVDRQRLTTVGSRRPGGMTSTYGRTPM    701 - 770
YGSQTPMYGSGSRTPMYGSQTPLQDGSRTPHYGSQTPLHDGSRTPAQSGAWDPNNPNTPSRAEEEYEYAF    771 - 840
DDEPTPSPQAYGGTPNPQTPGYPDPSSPQVNPQYNPQTPGTPAMYNTDQFSPYAAPSPQGSYQPSPSPQS    841 - 910
YHQVAPSPAGYQNTHSPASYHPTPSPMAYQASPSPSPVGYSPMTPGAPSPGGYNPHTPGSGIEQNSSDWV    911 - 980
TTDIQVKVRDTYLDTQVVGQTGVIRSVTGGMCSVYLKDSEKVVSISSEHLEPITPTKNNKVKVILGEDRE    981 - 1050
ATGVLLSIDGEDGIVRMDLDEQLKILNLRFLGKLLEA                                    1051 - 1087
//

Text Mined References (74)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
26903558 2016 Analysis of Subcellular RNA Fractions Revealed a Transcription-Independent Effect of Tumor Necrosis Factor Alpha on Splicing, Mediated by Spt5.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26418880 2015 Suppressor of Ty homolog-5, a novel tumor-specific human telomerase reverse transcriptase promoter-binding protein and activator in colon cancer cells.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25416956 2014 A proteome-scale map of the human interactome network.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24101474 2013 Structural basis for Spt5-mediated recruitment of the Paf1 complex to chromatin.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
More...