Property Summary

NCBI Gene PubMed Count 71
PubMed Score 1353.67
PubTator Score 125.94

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
Alzheimer's disease -1.300 3.3e-02
atypical teratoid/rhabdoid tumor 1.300 1.4e-02
diabetes mellitus -1.100 1.1e-02
Duchenne muscular dystrophy 1.033 1.1e-06
interstitial cystitis -1.100 1.2e-03
intraductal papillary-mucinous neoplasm ... 1.100 4.1e-02
invasive ductal carcinoma -1.031 1.1e-03
lung adenocarcinoma 1.194 3.2e-06
osteosarcoma 4.129 1.7e-08
ovarian cancer -1.200 1.5e-04
pancreatic cancer 1.400 4.6e-04
pancreatic carcinoma 1.400 4.6e-04
pancreatic ductal adenocarcinoma liver m... -2.784 5.2e-03
Pick disease -1.700 2.2e-05
ulcerative colitis -1.200 1.9e-06

 GO Process (1)

Gene RIF (57)

AA Sequence

MAAEDVVATGADPSDLESGGLLHEIFTSPLNLLLLGLCIFLLYKIVRGDQPAASGDSDDDEPPPLPRLKR      1 - 70
RDFTPAELRRFDGVQDPRILMAINGKVFDVTKGRKFYGPEGPYGVFAGRDASRGLATFCLDKEALKDEYD     71 - 140
DLSDLTAAQQETLSDWESQFTFKYHHVGKLLKEGEEPTVYSDEEEPKDESARKND                   141 - 195
//

Text Mined References (94)

PMID Year Title