Property Summary

NCBI Gene PubMed Count 61
Grant Count 120
R01 Count 56
Funding $11,930,274.27
PubMed Score 1293.24
PubTator Score 125.94

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Synonym

Accession O00264 B7Z1L3 Q9UGJ9 mPR
Symbols MPR
HPR6.6

Gene

PANTHER Protein Class (1)

PDB

4X8Y  

Gene RIF (48)

PMID Text
26988023 Haem-mediated PGRMC1 dimerization is required for interactions with EGFR and cytochromes P450, cancer proliferation and chemoresistance against anti-cancer drugs.
26870805 These results clarify that PGRMC1 and the S2R are distinct binding sites expressed by different genes.
26657863 indicate that PGRMC1 regulates hepcidin gene expression through an evolutionarily conserved mechanism
26447367 PGRMC1 is the major progesterone receptor eliciting the protective effects of Norgestrel, a synthetic female progesterone hormone.
25843410 results suggested that PGRMC1 and sigma2 receptors are two different molecular entities.
25675345 progesterone binds to hPGRMC1 and introduces spectral changes that manifest conformational changes to the heme.
25596698 PGRMC1 overexpression led to the epithelial-mesenchymal transition and chemoresistance in uterine sarcoma.
25304370 Loss of PGRMC1 expression is associated with endometrial tumor cell viability during chemotherapeutic stress.
25246111 coding mutations of PGRMC1 do not seem to be a common cause of the disease in Han Chinese
24680695 PGRMC1 expression appears to be diminished in pregnant women with preterm premature rupture of the membranes.
More...

AA Sequence

MAAEDVVATGADPSDLESGGLLHEIFTSPLNLLLLGLCIFLLYKIVRGDQPAASGDSDDDEPPPLPRLKR      1 - 70
RDFTPAELRRFDGVQDPRILMAINGKVFDVTKGRKFYGPEGPYGVFAGRDASRGLATFCLDKEALKDEYD     71 - 140
DLSDLTAAQQETLSDWESQFTFKYHHVGKLLKEGEEPTVYSDEEEPKDESARKND                   141 - 195
//

Text Mined References (79)

PMID Year Title
27599036 2016 A Novel Role for Progesterone Receptor Membrane Component 1 (PGRMC1): A Partner and Regulator of Ferrochelatase.
26988023 2016 Haem-dependent dimerization of PGRMC1/Sigma-2 receptor facilitates cancer proliferation and chemoresistance.
26870805 2015 The Sigma-2 Receptor and Progesterone Receptor Membrane Component 1 are Different Binding Sites Derived From Independent Genes.
26657863 2016 Progesterone receptor membrane component-1 regulates hepcidin biosynthesis.
26447367 2016 Progesterone receptor signalling in retinal photoreceptor neuroprotection.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25843410 2015 Elements in support of the 'non-identity' of the PGRMC1 protein with the ?2 receptor.
25675345 2015 Spectroscopic and mutagenesis studies of human PGRMC1.
25596698 2015 PGRMC1 contributes to doxorubicin-induced chemoresistance in MES-SA uterine sarcoma.
25304370 2015 Progesterone receptor membrane component 1 deficiency attenuates growth while promoting chemosensitivity of human endometrial xenograft tumors.
More...