Property Summary

NCBI Gene PubMed Count 48
PubMed Score 21.91
PubTator Score 120.24

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.600 1.7e-03
Breast cancer 2.700 4.2e-02
ductal carcinoma in situ 1.100 2.2e-03
glioblastoma 1.600 8.9e-05
group 4 medulloblastoma 1.400 1.1e-02
intraductal papillary-mucinous neoplasm ... 2.000 3.7e-03
invasive ductal carcinoma 1.800 3.8e-03
juvenile dermatomyositis 2.170 2.1e-13
medulloblastoma, large-cell 1.100 8.3e-05
osteosarcoma 1.194 1.6e-04
ovarian cancer 2.400 7.9e-08
primitive neuroectodermal tumor 1.600 7.5e-05
Rheumatoid arthritis 1.100 4.8e-02
tuberculosis and treatment for 6 months 1.400 6.1e-06
ulcerative colitis 1.700 3.6e-06

Gene RIF (24)

AA Sequence

MELPAVGEHVFAVESIEKKRIRKGRVEYLVKWRGWSPKYNTWEPEENILDPRLLIAFQNRERQEQLMGYR      1 - 70
KRGPKPKPLVVQVPTFARRSNVLTGLQDSSTDNRAKLDLGAQGKGQGHQYELNSKKHHQYQPHSKERAGK     71 - 140
PPPPGKSGKYYYQLNSKKHHPYQPDPKMYDLQYQGGHKEAPSPTCPDLGAKSHPPDKWAQGAGAKGYLGA    141 - 210
VKPLAGAAGAPGKGSEKGPPNGMMPAPKEAVTGNGIGGKMKIVKNKNKNGRIVIVMSKYMENGMQAVKIK    211 - 280
SGEVAEGEARSPSHKKRAADERHPPADRTFKKAAGAEEKKVEAPPKRREEEVSGVSDPQPQDAGSRKLSP    281 - 350
TKEAFGEQPLQLTTKPDLLAWDPARNTHPPSHHPHPHPHHHHHHHHHHHHAVGLNLSHVRKRCLSETHGE    351 - 420
REPCKKRLTARSISTPTCLGGSPAAERPADLPPAAALPQPEVILLDSDLDEPIDLRCVKTRSEAGEPPSS    421 - 490
LQVKPETPASAAVAVAAAAAPTTTAEKPPAEAQDEPAESLSEFKPFFGNIIITDVTANCLTVTFKEYVTV    491 - 560
//

Text Mined References (61)

PMID Year Title