Property Summary

NCBI Gene PubMed Count 44
Grant Count 12
R01 Count 12
Funding $692,271.64
PubMed Score 17.37
PubTator Score 120.24

Knowledge Summary

Patent

No data available

Expression

Gene RIF (21)

PMID Text
25766328 Cbx4 is an independent prognostic factor for HCC patients, and the patients with high Cbx4 expression should receive postoperative TACE treatment to improve their survival
25607636 our study demonstrated that miR-195 acts as a tumor suppressor by directly targeting CBX4 in hepatocellular carcinoma
24838576 Role of Cbx4 in migration and metastasis of a metastatic hepatocellular carcinoma cell line. Results show that Cbx4 overexpression increases the in vitro vessel formation of vascular endothelial cells in its SUMO interaction motifs-dependent manner.
24460908 The presence of CBX4-GFP in the same focus had a minor impact on BMI1 and RING1 recovery kinetics.
24434214 our findings demonstrate that Cbx4 plays a critical role in tumor angiogenesis by governing HIF-1alpha protein
23943028 High cytoplasmic expression of CBX4 is associated with hepatocellular carcinoma.
22897849 ASXL1 associates with the PRC2 and loss of ASXL1 in vivo collaborates with NRASG12D to promote myeloid leukemogenesis.
22078878 Pc2, methylation controls the protein's interaction with two distinct ncRNAs, TUG1 and NEAT2, which results in the exclusive subnuclear localization of methylated and unmethylated Pc2 in Polycomb bodies and interchromatin granules, respectively.
22028491 High Polycomb repressive complex protein is associated with mesothelioma.
21885019 plays role in regulation of epidermal stem cell proliferation and senescence
More...

AA Sequence

MELPAVGEHVFAVESIEKKRIRKGRVEYLVKWRGWSPKYNTWEPEENILDPRLLIAFQNRERQEQLMGYR      1 - 70
KRGPKPKPLVVQVPTFARRSNVLTGLQDSSTDNRAKLDLGAQGKGQGHQYELNSKKHHQYQPHSKERAGK     71 - 140
PPPPGKSGKYYYQLNSKKHHPYQPDPKMYDLQYQGGHKEAPSPTCPDLGAKSHPPDKWAQGAGAKGYLGA    141 - 210
VKPLAGAAGAPGKGSEKGPPNGMMPAPKEAVTGNGIGGKMKIVKNKNKNGRIVIVMSKYMENGMQAVKIK    211 - 280
SGEVAEGEARSPSHKKRAADERHPPADRTFKKAAGAEEKKVEAPPKRREEEVSGVSDPQPQDAGSRKLSP    281 - 350
TKEAFGEQPLQLTTKPDLLAWDPARNTHPPSHHPHPHPHHHHHHHHHHHHAVGLNLSHVRKRCLSETHGE    351 - 420
REPCKKRLTARSISTPTCLGGSPAAERPADLPPAAALPQPEVILLDSDLDEPIDLRCVKTRSEAGEPPSS    421 - 490
LQVKPETPASAAVAVAAAAAPTTTAEKPPAEAQDEPAESLSEFKPFFGNIIITDVTANCLTVTFKEYVTV    491 - 560
//

Text Mined References (55)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25766328 2015 Prognostic significance of Cbx4 expression and its beneficial effect for transarterial chemoembolization in hepatocellular carcinoma.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25607636 2015 MicroRNA-195 functions as a tumor suppressor by inhibiting CBX4 in hepatocellular carcinoma.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
24838576 2014 Polycomb chromobox 4 enhances migration and pulmonary metastasis of hepatocellular carcinoma cell line MHCC97L.
24528284 2014 Citalopram and escitalopram plasma drug and metabolite concentrations: genome-wide associations.
24460908 2014 PRC1 components exhibit different binding kinetics in Polycomb bodies.
More...