Property Summary

NCBI Gene PubMed Count 235
Grant Count 207
R01 Count 81
Funding $27,220,531.74
PubMed Score 1706.06
PubTator Score 1422.47

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
malignant mesothelioma 1.200 0.000
colon cancer 2.100 0.031
lung cancer 1.100 0.014

Synonym

Gene

PDB

3U88   3U84   3U85   3U86   4GPQ   4GQ3   4GQ4   4GQ6   4I80   4OG3   4OG4   4OG5   4OG6   4OG7   4OG8   4X5Y   4X5Z   5DB0   5DB1   5DB2   5DB3   5DD9   5DDA   5DDB   5DDC   5DDD   5DDE   5DDF  

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
2781 screening 13 / 0 / 50 Confirmation of Inhibitors Targeting the Menin-MLL Interaction in MLL Related Leukemias: NMR spectroscopy to verify direct binding of compounds to menin

Gene RIF (195)

PMID Text
26990989 progenitors. Our findings define SON as a fine-tuner of the MLL-menin interaction and reveal short SON overexpression as a marker indicating aberrant transcriptional initiation in leukemia.
26560942 cellular staining for menin also reveals the distribution of menin in the cell membrane and the punctate-like cell organelles
26454216 interaction between menin and Dnmt1 reversibly regulates pancreatic cancer cell growth downstream of Hedgehog pathways with complex mutual modulation networks.
26307114 Molecular analysis of sporadic insulinoma revealed presence of three novel exonic mutations, two novel intronic variations, three reported exon SNPs, and one intronic SNP (rs669976).
26239674 novel MEN1 c.8251G>A mutation in a family with multiple endocrine neoplasia type 1
25962847 Data show that menin, encoded by the MEN1 gene, inhibits the transcriptional activity of nuclear receptor liver X receptor alpha (LXRalpha).
25822367 Menin expression is higher in castration-resistant prostate cancer than in both hormone-naive prostate cancer and benign prostate tissue, and high menin expression correlates with poor overall survival
25753880 miR-17 could inhibit protein levels of Menin through targeting its 3'-untranslated region
25625803 Mutations of MEN1 gene in a subset of Hurthle cell tumors point to a potential role for this protein and its associated pathways in thyroid tumorigenesis.
25517963 Conditional knockout of beta-catenin suppresses the tumorigenesis and growth of Men1-deficient pancreatic neuroendocrine tumors.
More...

AA Sequence

MGLKAAQKTLFPLRSIDDVVRLFAAELGREEPDLVLLSLVLGFVEHFLAVNRVIPTNVPELTFQPSPAPD      1 - 70
PPGGLTYFPVADLSIIAALYARFTAQIRGAVDLSLYPREGGVSSRELVKKVSDVIWNSLSRSYFKDRAHI     71 - 140
QSLFSFITGWSPVGTKLDSSGVAFAVVGACQALGLRDVHLALSEDHAWVVFGPNGEQTAEVTWHGKGNED    141 - 210
RRGQTVNAGVAERSWLYLKGSYMRCDRKMEVAFMVCAINPSIDLHTDSLELLQLQQKLLWLLYDLGHLER    211 - 280
YPMALGNLADLEELEPTPGRPDPLTLYHKGIASAKTYYRDEHIYPYMYLAGYHCRNRNVREALQAWADTA    281 - 350
TVIQDYNYCREDEEIYKEFFEVANDVIPNLLKEAASLLEAGEERPGEQSQGTQSQGSALQDPECFAHLLR    351 - 420
FYDGICKWEEGSPTPVLHVGWATFLVQSLGRFEGQVRQKVRIVSREAEAAEAEEPWGEEAREGRRRGPRR    421 - 490
ESKPEEPPPPKKPALDKGLGTGQGAVSGPPRKPPGTVAGTARGPEGGSTAQVPAPTASPPPEGPVLTFQS    491 - 560
EKMKGMKELLVATKINSSAIKLQLTAQSQVQMKKQKVSTPSDYTLSFLKRQRKGL                   561 - 615
//

Text Mined References (269)

PMID Year Title
26990989 2016 SON and Its Alternatively Spliced Isoforms Control MLL Complex-Mediated H3K4me3 and Transcription of Leukemia-Associated Genes.
26560942 2016 Menin localization in cell membrane compartment.
26454216 2016 Interplay between menin and Dnmt1 reversibly regulates pancreatic cancer cell growth downstream of the Hedgehog signaling pathway.
26307114 2015 Novel MEN 1 gene findings in rare sporadic insulinoma--a case control study.
26239674 2015 MEN1 c.825?1G>A mutation in a family with multiple endocrine neoplasia type 1: A case report.
25962847 2015 Tumor suppressor Menin acts as a corepressor of LXR? to inhibit hepatic lipogenesis.
25822367 2015 Targeting the MLL complex in castration-resistant prostate cancer.
25753880 2015 Glucose-induced microRNA-17 promotes pancreatic beta cell proliferation through down-regulation of Menin.
25625803 2015 MEN1 mutations in Hürthle cell (oncocytic) thyroid carcinoma.
25517963 2014 Targeting ?-catenin signaling for therapeutic intervention in MEN1-deficient pancreatic neuroendocrine tumours.
More...