Property Summary

Ligand Count 49
NCBI Gene PubMed Count 249
PubMed Score 1803.03
PubTator Score 1422.47

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count
Hyperparathyroidism 48
Zollinger-Ellison syndrome 18
Pituitary adenoma 38
Parathyroid Adenoma 19
Hypercalcemia 59
Acromegaly 51
Hypoglycemia 152
Abdominal pain, episodic 9
Abnormality of hair density 2
Abnormality of the pancreatic islet cells 4
Adrenal cortical adenoma 19
Adrenocorticotropic hormone (ACTH) deficiency (disorder) 4
Adrenocorticotropin deficient adrenal insufficiency 4
Amnesia, Transient Global 9
Angiofibroma 7
Birthmark 35
Cafe-au-Lait Spots 37
Calcium pyrophosphate deposition disease 13
Carcinoid Tumor 2
Confetti-like hypopigmented macules 3
Decreased circulating ACTH level 12
Decreased female libido 3
Decreased fertility in females 20
Decreased male fertility 7
Decreased visual acuity, progressive 36
Diarrhea 253
Dyspareunia 12
Easy fatigability 18
Epilepsy 792
Erectile dysfunction 32
Esophagitis 35
Fatigue 182
Female hypogonadism syndrome 25
Fibrous skin tumor of tuberous sclerosis 18
Fluctuations in consciousness 3
Galactorrhea 5
Generalized muscle weakness 57
Generalized osteopenia 99
Generalized osteoporosis with pathologic fractures 6
Growth hormone excess 14
Gynecomastia 64
Headache 37
Hypercalcemia, Infantile 3
Hypercalciuria 27
Hyperhidrosis disorder 81
Hyperinsulinaemic hypoglycaemia 16
Hyperinsulinemia, fasting 7
Hyperparathyroidism, Primary 3
Hyperphagia 23
Hyperphosphaturia 21
Hypogonadism, Isolated Hypogonadotropic 71
Hypogonadotropic hypogonadism 89
Hypophosphatemia 40
Hypotension 82
Increased appetite (finding) 23
Increased calcium level in kidney 21
Increased circulating cortisol level 7
Increased serum parathyroid hormone 14
Increased sweating 81
Nephrocalcinosis 35
Non-Functioning Pituitary Gland Neoplasm 6
Nonketotic hypoglycemia 6
Osteopenia 99
Osteoporosis 363
Pallor 40
Palpitations 18
Pancreatic Neoplasm 85
Parathyroid hyperplasia 6
Peptic Ulcer 27
Pituitary growth hormone cell adenoma 8
Progressive visual loss 36
Prolactinoma 11
Reactive hypoglycemia 2
Recurrent hypoglycemia 4
Sebaceous adenoma 26
Secondary growth hormone deficiency 2
Secondary hypothyroidism 15
Seizures 596
Subcutaneous lipomas 9
Sweating 81
Testicular hypogonadism 21
Thyroid Diseases 24
Thyroid Gland Follicular Adenoma 9
Tires quickly 18
Tremor 113
Urine phosphorous concentration above normal 21
Vomiting 116
Weight Gain 100
intermittent abdominal pain 9
menstrual periods stopped for over 6 months 13
Disease Target Count P-value
malignant mesothelioma 3232 1.1e-05
lung cancer 4740 1.4e-02
colon cancer 1478 3.1e-02

Expression

  Differential Expression (3)

Disease log2 FC p
lung cancer 1.100 1.4e-02
colon cancer 2.100 3.1e-02
malignant mesothelioma 1.200 1.1e-05

Gene RIF (209)

AA Sequence

MGLKAAQKTLFPLRSIDDVVRLFAAELGREEPDLVLLSLVLGFVEHFLAVNRVIPTNVPELTFQPSPAPD      1 - 70
PPGGLTYFPVADLSIIAALYARFTAQIRGAVDLSLYPREGGVSSRELVKKVSDVIWNSLSRSYFKDRAHI     71 - 140
QSLFSFITGWSPVGTKLDSSGVAFAVVGACQALGLRDVHLALSEDHAWVVFGPNGEQTAEVTWHGKGNED    141 - 210
RRGQTVNAGVAERSWLYLKGSYMRCDRKMEVAFMVCAINPSIDLHTDSLELLQLQQKLLWLLYDLGHLER    211 - 280
YPMALGNLADLEELEPTPGRPDPLTLYHKGIASAKTYYRDEHIYPYMYLAGYHCRNRNVREALQAWADTA    281 - 350
TVIQDYNYCREDEEIYKEFFEVANDVIPNLLKEAASLLEAGEERPGEQSQGTQSQGSALQDPECFAHLLR    351 - 420
FYDGICKWEEGSPTPVLHVGWATFLVQSLGRFEGQVRQKVRIVSREAEAAEAEEPWGEEAREGRRRGPRR    421 - 490
ESKPEEPPPPKKPALDKGLGTGQGAVSGPPRKPPGTVAGTARGPEGGSTAQVPAPTASPPPEGPVLTFQS    491 - 560
EKMKGMKELLVATKINSSAIKLQLTAQSQVQMKKQKVSTPSDYTLSFLKRQRKGL                   561 - 615
//

Text Mined References (283)

PMID Year Title