Property Summary

NCBI Gene PubMed Count 61
Grant Count 275
R01 Count 199
Funding $19,981,124.84
PubMed Score 2.70
PubTator Score 55.78

Knowledge Summary

Patent (8,637)

Expression

Synonym

Accession O00254 B2R754 B4DQ13 Q52M68 Q7Z3W3 PAR-3
Symbols PAR3
PAR-3

Gene

PANTHER Protein Class (2)

  TechDev Info (1)

Gene RIF (33)

PMID Text
26742564 PAR3 is essential in thrombin stimulated insulin secretion.
26729042 TFRGAP, a PAR-3 mimicking peptide significantly induced the phosphorylation of eNOS-Thr-495 with minimal phosphorylation of eNOS-Ser-1177 with no change in nitric oxide production.
25320242 These data provide intriguing novel insights into the diversification of functional selectivity of protease signaling achievable by canonical and noncanonical PAR activation, such as the activation of vascular-protective Tie2 by noncanonical PAR3 activation.
24699825 In pancreatic adenocarcinoma cells, PAR3 knockdown enhances cell adhesion. We propose this is due to increased expression of E-cadherin, leading to a greater adhesion of free-floating cells to cells bound to the surface via integrins, particularly ITGalphav.
23921961 Data indicate that knockdowns of all three PARs PAR-1, PAR-2, and PAR-3 exhibited changes in the expression of CDC42, which correlated with the changes in their invasion.
23788139 A unique contributory role for PAR3 in the complex mechanisms underlying Activated protein C cytoprotective effects.
23739922 Elevated expression of PAR-3, but not PAR-4, was detected in the lungs of idiopathic pulmonary fibrosis patients.
23333304 HIV-1 Vif downregulates the expression of coagulation factor II (thrombin) receptor-like 2 (F2RL2) in Vif-expression T cells
22541814 PAR-3 receptors interact with thrombin and increase heme oxygenase-1 expression in synovial fibroblasts.
21596928 Human PAR-3 is regulated post-transcriptionally via the mRNA-stabilizing factor HuR, whereas transcriptional control involves nuclear factor of activated T cells (NFAT).
More...

AA Sequence

MKALIFAAAGLLLLLPTFCQSGMENDTNNLAKPTLPIKTFRGAPPNSFEEFPFSALEGWTGATITVKIKC      1 - 70
PEESASHLHVKNATMGYLTSSLSTKLIPAIYLLVFVVGVPANAVTLWMLFFRTRSICTTVFYTNLAIADF     71 - 140
LFCVTLPFKIAYHLNGNNWVFGEVLCRATTVIFYGNMYCSILLLACISINRYLAIVHPFTYRGLPKHTYA    141 - 210
LVTCGLVWATVFLYMLPFFILKQEYYLVQPDITTCHDVHNTCESSSPFQLYYFISLAFFGFLIPFVLIIY    211 - 280
CYAAIIRTLNAYDHRWLWYVKASLLILVIFTICFAPSNIILIIHHANYYYNNTDGLYFIYLIALCLGSLN    281 - 350
SCLDPFLYFLMSKTRNHSTAYLTK                                                  351 - 374
//

Text Mined References (64)

PMID Year Title
26742564 2015 Thrombin stimulates insulin secretion via protease-activated receptor-3.
26729042 2016 Featured Article: Differential regulation of endothelial nitric oxide synthase phosphorylation by protease-activated receptors in adult human endothelial cells.
25320242 2014 Noncanonical PAR3 activation by factor Xa identifies a novel pathway for Tie2 activation and stabilization of vascular integrity.
24699825 2014 PAR-3 knockdown enhances adhesion rate of PANC-1 cells via increased expression of integrin?v and E-cadherin.
23921961 2014 Proteinase-activated receptors differentially modulate in vitro invasion of human pancreatic adenocarcinoma PANC-1 cells in correlation with changes in the expression of CDC42 protein.
23788139 2013 Novel mechanisms for activated protein C cytoprotective activities involving noncanonical activation of protease-activated receptor 3.
23739922 2013 Protease-activated receptors (PAR)-1 and -3 drive epithelial-mesenchymal transition of alveolar epithelial cells - potential role in lung fibrosis.
22541814 2012 Thrombin induces heme oxygenase-1 expression in human synovial fibroblasts through protease-activated receptor signaling pathways.
21596928 2011 Regulation of human vascular protease-activated receptor-3 through mRNA stabilization and the transcription factor nuclear factor of activated T cells (NFAT).
20930172 2010 Activation of protease-activated receptors 3 and 4 accelerates tissue factor-induced thrombin generation on the surface of vascular smooth muscle cells.
More...