Property Summary

NCBI Gene PubMed Count 61
PubMed Score 2.70
PubTator Score 55.78

Knowledge Summary

Patent (8,637)

Expression

  Differential Expression (13)

Disease log2 FC p
adult high grade glioma 1.500 8.3e-03
atypical teratoid / rhabdoid tumor 2.100 2.1e-03
Breast cancer 1.500 3.8e-04
ductal carcinoma in situ 3.200 1.8e-03
ependymoma 2.000 3.1e-04
fibroadenoma 2.100 7.8e-03
glioblastoma 1.500 4.4e-03
invasive ductal carcinoma 2.300 3.9e-02
malignant mesothelioma -1.100 1.8e-05
non-small cell lung cancer 1.141 5.0e-05
pancreatic cancer 2.900 2.1e-03
primary pancreatic ductal adenocarcinoma 2.875 1.2e-03
sonic hedgehog group medulloblastoma 1.500 4.4e-02

Gene RIF (33)

AA Sequence

MKALIFAAAGLLLLLPTFCQSGMENDTNNLAKPTLPIKTFRGAPPNSFEEFPFSALEGWTGATITVKIKC      1 - 70
PEESASHLHVKNATMGYLTSSLSTKLIPAIYLLVFVVGVPANAVTLWMLFFRTRSICTTVFYTNLAIADF     71 - 140
LFCVTLPFKIAYHLNGNNWVFGEVLCRATTVIFYGNMYCSILLLACISINRYLAIVHPFTYRGLPKHTYA    141 - 210
LVTCGLVWATVFLYMLPFFILKQEYYLVQPDITTCHDVHNTCESSSPFQLYYFISLAFFGFLIPFVLIIY    211 - 280
CYAAIIRTLNAYDHRWLWYVKASLLILVIFTICFAPSNIILIIHHANYYYNNTDGLYFIYLIALCLGSLN    281 - 350
SCLDPFLYFLMSKTRNHSTAYLTK                                                  351 - 374
//

Text Mined References (64)

PMID Year Title