Property Summary

NCBI Gene PubMed Count 57
Grant Count 571
R01 Count 415
Funding $41,777,587.9
PubMed Score 471.41
PubTator Score 241.74

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession O00253 O15459 Q2TBD9
Symbols ART
AGRT
ASIP2

Gene

PANTHER Protein Class (1)

PDB

2IQV   1HYK   1MR0  

Gene RIF (41)

PMID Text
26152765 CSF AgRP was not different in lean vs. overweight/obese subjects; however, plasma AgRP was higher in lean subjects.
25446108 human agouti-related protein has a role in enhancing expression and stability of human melanocortin-4 receptor
25013995 Elevations in AgRP also favor the diagnosis of ectopic ACTH syndrome, suggesting AgRP should be further evaluated as a potential neuroendocrine tumor marker.
24564533 AGRP SNP (rs1338993) was not associated with antipsychotic-induced weight gain in schizophrenia patients.
23900445 Variations in genes AGRP, CPE, GHRL, GLP1R, HTR2A, NPY1R, NPY5R, SOCS3 and STAT3 showed modest associations with BMI in European Americans.
23118421 Despite peripheral hyperleptinemia, positive energy balance is achieved during pregnancy by a relative decrease in central leptin concentrations and resistance to leptin's effects on target neuropeptides that regulate energy balance.
22492775 AgRP and NPY are correlated with body weight changes, rather than the presence of type 2 diabetes, whereas changes in alphaMSH immunoreactivity are related to the presence of type 2 diabetes, indicating separate hypothalamic mechanisms.
22477065 Data suggest that prolonged steady-state exercise/physical activity at moderate intensity elicits substantial increases in blood lactate and cortisol concentrations without a significant change in AgRP; study was pilot project involving men.
21531082 Cognitive flexibility plays an important role in anorexia nervosa and may be modulated by abnormal levels of the appetite-regulating peptide AGRP.
20468064 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MLTAAVLSCALLLALPATRGAQMGLAPMEGIRRPDQALLPELPGLGLRAPLKKTTAEQAEEDLLQEAQAL      1 - 70
AEVLDLQDREPRSSRRCVRLHESCLGQQVPCCDPCATCYCRFFNAFCYCRKLGTAMNPCSRT             71 - 132
//

Text Mined References (61)

PMID Year Title
26152765 2015 Proopiomelanocortin, agouti-related protein, and leptin in human cerebrospinal fluid: correlations with body weight and adiposity.
25446108 2015 Co-expression of human agouti-related protein enhances expression and stability of human melanocortin-4 receptor.
25013995 2014 Clinical utility of plasma POMC and AgRP measurements in the differential diagnosis of ACTH-dependent Cushing's syndrome.
24564533 2014 Investigation of melanocortin system gene variants in antipsychotic-induced weight gain.
23900445 2014 Genetic association analysis of 30 genes related to obesity in a European American population.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23118421 2013 Cerebrospinal fluid levels of leptin, proopiomelanocortin, and agouti-related protein in human pregnancy: evidence for leptin resistance.
22492775 2012 AgRP and NPY expression in the human hypothalamic infundibular nucleus correlate with body mass index, whereas changes in ?MSH are related to type 2 diabetes.
22477065 2012 Effects of prolonged exercise on agouti-related protein: a pilot study.
21531082 2011 Cognitive flexibility and Agouti-related protein in adolescent patients with anorexia nervosa.
More...