Property Summary

NCBI Gene PubMed Count 66
PubMed Score 143.73
PubTator Score 130.95

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Hepatitis, Chronic 23 0.0 0.0
Hypertension 396 0.0 0.0
Lung Neoplasms 232 0.0 0.0
Disease Target Count
Hypertensive disease 292
Disease Target Count P-value
ovarian cancer 8520 1.4e-05
osteosarcoma 7950 2.2e-03
acute myeloid leukemia 783 8.7e-03
Disease Target Count Z-score Confidence
Wilson disease 16 6.365 3.2
Menkes disease 19 5.391 2.7

Expression

  Differential Expression (3)

Disease log2 FC p
acute myeloid leukemia -1.300 8.7e-03
osteosarcoma -1.357 2.2e-03
ovarian cancer 1.800 1.4e-05

Gene RIF (54)

AA Sequence

MPKHEFSVDMTCGGCAEAVSRVLNKLGGVKYDIDLPNKKVCIESEHSMDTLLATLKKTGKTVSYLGLE        1 - 68
//

Text Mined References (70)

PMID Year Title