Property Summary

NCBI Gene PubMed Count 60
Grant Count 89
R01 Count 64
Funding $7,694,676.59
PubMed Score 131.46
PubTator Score 130.95

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma -1.357 0.002
acute myeloid leukemia -1.300 0.009
ovarian cancer 1.800 0.000

Synonym

Accession O00244 A8KAJ8 D3DQI2 Q2M1R6 Q56AP3
Symbols ATX1
HAH1

Gene

PANTHER Protein Class (1)

PDB

1FE0   1FE4   1FEE   1TL4   1TL5   2K1R   2LQ9   3CJK   3IWL   3IWX   4QOT   4YDX   4YEA  

Gene RIF (49)

PMID Text
26879543 Upon neuronal differentiation, transitions in redox states upregulates expression of ATOX1 and its partner ATP7A, producing higher flux of copper through the secretory pathway.
26866891 Multiple genetic models identified genetic associations with systolic blood pressure and ATOX1.
26784148 results suggest the possibility of a therapy with copper-chelating or ionophore drugs in subtypes of tumors showing specific alterations in ATOX1 expression
26745464 In addition to Atox1, the human cytoplasm also contains Cu chaperones for loading of superoxide dismutase 1 (i.e. CCS) and cytochrome c oxidase in mitochondria (i.e. Cox17). [review]
26745413 C-Terminus of Human Copper Importer Ctr1 Acts as a Binding Site and Transfers Copper to Atox1
26437801 Cu chaperone function of Atox1 mediated through Cu transporter ATP7A is required for VEGF-induced angiogenesis via activation of Cu enzyme lysyl oxidase.
26213915 To identify new interactions partners of Atox1, a yeast two-hybrid screen with a large human placenta library of cDNA fragments using Atox1 as bait, was performed.
25962064 Studied the localization of Atox1 in HeLa cells using fluorescence imaging in combination with in vitro binding experiments to fluorescently labeled DNA duplexes harboring the proposed promotor sequence.
25673218 Human cytoplasmic copper chaperones Atox1 and CCS exchange copper ions in vitro
25111319 Cisplatin is one of the most used anticancer drugs. Its cellular influx and delivery to target DNA may involve the copper chaperone Atox1 protein.
More...

AA Sequence

MPKHEFSVDMTCGGCAEAVSRVLNKLGGVKYDIDLPNKKVCIESEHSMDTLLATLKKTGKTVSYLGLE        1 - 68
//

Text Mined References (64)

PMID Year Title
26879543 2016 Neuronal differentiation is associated with a redox-regulated increase of copper flow to the secretory pathway.
26866891 2016 Longitudinal analytical approaches to genetic data.
26784148 2016 ATOX1 gene silencing increases susceptibility to anticancer therapy based on copper ionophores or chelating drugs.
26745464 2016 Extended functional repertoire for human copper chaperones.
26745413 2016 The C-Terminus of Human Copper Importer Ctr1 Acts as a Binding Site and Transfers Copper to Atox1.
26437801 2015 Copper Transport Protein Antioxidant-1 Promotes Inflammatory Neovascularization via Chaperone and Transcription Factor Function.
26213915 2015 Identification of New Potential Interaction Partners for Human Cytoplasmic Copper Chaperone Atox1: Roles in Gene Regulation?
25962064 2015 Human Copper Chaperone Atox1 Translocates to the Nucleus but does not Bind DNA In Vitro.
25673218 2015 Human cytoplasmic copper chaperones Atox1 and CCS exchange copper ions in vitro.
25416956 2014 A proteome-scale map of the human interactome network.
More...