Property Summary

NCBI Gene PubMed Count 21
PubMed Score 8.38
PubTator Score 9.89

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

 GWAS Trait (1)

Protein-protein Interaction (1)

Gene RIF (7)

AA Sequence

MPVPASWPHLPSPFLLMTLLLGRLTGVAGEDELQVIQPEKSVSVAAGESATLRCAMTSLIPVGPIMWFRG      1 - 70
AGAGRELIYNQKEGHFPRVTTVSELTKRNNLDFSISISNITPADAGTYYCVKFRKGSPDDVEFKSGAGTE     71 - 140
LSVRAKPSAPVVSGPAVRATPEHTVSFTCESHGFSPRDITLKWFKNGNELSDFQTNVDPAGDSVSYSIHS    141 - 210
TARVVLTRGDVHSQVICEIAHITLQGDPLRGTANLSEAIRVPPTLEVTQQPMRAENQANVTCQVSNFYPR    211 - 280
GLQLTWLENGNVSRTETASTLIENKDGTYNWMSWLLVNTCAHRDDVVLTCQVEHDGQQAVSKSYALEISA    281 - 350
HQKEHGSDITHEAALAPTAPLLVALLLGPKLLLVVGVSAIYICWKQKA                          351 - 398
//

Text Mined References (23)

PMID Year Title