Property Summary

NCBI Gene PubMed Count 84
Grant Count 71
R01 Count 61
Funding $6,157,478.62
PubMed Score 74.22
PubTator Score 61.39

Knowledge Summary

Patent (9,109)

Expression

  Differential Expression (20)

Synonym

Accession O00238 B2R953 B4DSV1 P78366 BMP type-1B receptor
Symbols ALK6
AMDD
BDA2
ALK-6
BDA1D
CDw293

Gene

PDB

3MDY  

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448
686923 other 8 / 0 / 2 In vitrocounter assay of key BMP4 Inhibitors

Gene RIF (44)

PMID Text
26684357 Low expression of BMPRIB is associated with breast cancer.
26562759 Using computational analyses with the COREX/BEST algorithm, the study uncovered an overall pattern connecting various regions of BMPR-1B ectodomain, including the four conserved residues in the protein-protein interface.
26105076 Data found a hypomorphic BMPR1B mutation causes du Pan acromesomelic dysplasia
25776145 Novel mutation in the BMPR1B gene (R486L) in a Polish family and further delineation of the phenotypic features of BMPR1B-related brachydactyly.
25758993 Two novel mutations in BMPR1B were identified in two patients with brachydactyly type A1.
25601208 Disequilibrium of BMP2 levels in the breast stem cell niche launches epithelial transformation by overamplifying BMPR1B cell response.
24339876 Disrupting the binding of miR-125b toward BMPR1B would increase protein expression, diminishing abnormal cell proliferation as well as serum and cellular CA125 levels
24129431 Data indicate missense (c.157T>C, p.(C53R)) or nonsense (c.657G>A, p.(W219*)) mutations in bone morphogenetic protein receptor type IB (BMPR1B) in two consanguineous families with acromesomelic chondrodysplasia-type Grebe.
24100446 Using primary cells and a cell line mimicking CP-CML, we found that myeloid progenitor expansion is driven by the exposure of immature cells overexpressing BMP receptor Ib to BMP2 and BMP4.
24021264 the shear-induced apoptosis and autophagy are mediated by bone morphogenetic protein receptor type (BMPR)-IB, BMPR-specific Smad1 and Smad5, and p38 mitogen-activated protein kinase.
More...

AA Sequence

MLLRSAGKLNVGTKKEDGESTAPTPRPKVLRCKCHHHCPEDSVNNICSTDGYCFTMIEEDDSGLPVVTSG      1 - 70
CLGLEGSDFQCRDTPIPHQRRSIECCTERNECNKDLHPTLPPLKNRDFVDGPIHHRALLISVTVCSLLLV     71 - 140
LIILFCYFRYKRQETRPRYSIGLEQDETYIPPGESLRDLIEQSQSSGSGSGLPLLVQRTIAKQIQMVKQI    141 - 210
GKGRYGEVWMGKWRGEKVAVKVFFTTEEASWFRETEIYQTVLMRHENILGFIAADIKGTGSWTQLYLITD    211 - 280
YHENGSLYDYLKSTTLDAKSMLKLAYSSVSGLCHLHTEIFSTQGKPAIAHRDLKSKNILVKKNGTCCIAD    281 - 350
LGLAVKFISDTNEVDIPPNTRVGTKRYMPPEVLDESLNRNHFQSYIMADMYSFGLILWEVARRCVSGGIV    351 - 420
EEYQLPYHDLVPSDPSYEDMREIVCIKKLRPSFPNRWSSDECLRQMGKLMTECWAHNPASRLTALRVKKT    421 - 490
LAKMSESQDIKL                                                              491 - 502
//

Text Mined References (87)

PMID Year Title
26684357 2016 Low expression of BMPRIB indicates poor prognosis of breast cancer and is insensitive to taxane-anthracycline chemotherapy.
26562759 2015 Long-Range Communication Network in the Type 1B Bone Morphogenetic Protein Receptor.
26105076 2015 A hypomorphic BMPR1B mutation causes du Pan acromesomelic dysplasia.
25776145 2015 Novel mutation in the BMPR1B gene (R486L) in a Polish family and further delineation of the phenotypic features of BMPR1B-related brachydactyly.
25758993 2015 Two novel disease-causing variants in BMPR1B are associated with brachydactyly type A1.
25601208 2015 Disequilibrium of BMP2 levels in the breast stem cell niche launches epithelial transformation by overamplifying BMPR1B cell response.
24904118 2014 HFE interacts with the BMP type I receptor ALK3 to regulate hepcidin expression.
24529757 2014 Genome-wide association study combining pathway analysis for typical sporadic amyotrophic lateral sclerosis in Chinese Han populations.
24339876 2013 BMPR1B up-regulation via a miRNA binding site variation defines endometriosis susceptibility and CA125 levels.
24129431 2014 Homozygous missense and nonsense mutations in BMPR1B cause acromesomelic chondrodysplasia-type Grebe.
More...