Property Summary

NCBI Gene PubMed Count 13
PubMed Score 32.75
PubTator Score 27.67

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession O00237 A6NFV6 B2RAG4 Q53SU6 Q8IVB9
Symbols KF1
KF-1
HKF-1
ZFP103
ZFP-103

Gene

Gene RIF (2)

PMID Text
18675248 Kf-1 is an ER ubiquitin ligase involved in the endoplasmic reticulum-associated degradation pathway.
18615712 Analysis reveals that the main determinants of selectivity between ubiquitin ligases RNF103 and E2 ubiquitin-conjugating enzymes resides on ring domains, rather than on the E2s.

AA Sequence

MWLKLFFLLLYFLVLFVLARFFEAIVWYETGIFATQLVDPVALSFKKLKTILECRGLGYSGLPEKKDVRE      1 - 70
LVEKSGDLMEGELYSALKEEEASESVSSTNFSGEMHFYELVEDTKDGIWLVQVIANDRSPLVGKIHWEKM     71 - 140
VKKVSRFGIRTGTFNCSSDPRYCRRRGWVRSTLIMSVPQTSTSKGKVMLKEYSGRKIEVEHIFKWITAHA    141 - 210
ASRIKTIYNAEHLKEEWNKSDQYWLKIYLFANLDQPPAFFSALSIKFTGRVEFIFVNVENWDNKSYMTDI    211 - 280
GIYNMPSYILRTPEGIYRYGNHTGEFISLQAMDSFLRSLQPEVNDLFVLSLVLVNLMAWMDLFITQGATI    281 - 350
KRFVVLISTLGTYNSLLIISWLPVLGFLQLPYLDSFYEYSLKLLRYSNTTTLASWVRADWMFYSSHPALF    351 - 420
LSTYLGHGLLIDYFEKKRRRNNNNDEVNANNLEWLSSLWDWYTSYLFHPIASFQNFPVESDWDEDPDLFL    421 - 490
ERLAFPDLWLHPLIPTDYIKNLPMWRFKCLGVQSEEEMSEGSQDTENDSESENTDTLSSEKEVFEDKQSV    491 - 560
LHNSPGTASHCDAEACSCANKYCQTSPCERKGRSYGSYNTNEDMEPDWLTWPADMLHCTECVVCLENFEN    561 - 630
GCLLMGLPCGHVFHQNCIVMWLAGGRHCCPVCRWPSYKKKQPYAQHQPLSNDVPS                   631 - 685
//

Text Mined References (13)

PMID Year Title
18675248 2008 Ubiquitin ligase Kf-1 is involved in the endoplasmic reticulum-associated degradation pathway.
18615712 2009 Analysis of electrostatic contributions to the selectivity of interactions between RING-finger domains and ubiquitin-conjugating enzymes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16275323 2005 Expression and evaluation of RING finger proteins.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12658376 2003 Induction of kf-1 after repeated electroconvulsive treatment and chronic antidepressant treatment in rat frontal cortex and hippocampus.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11071867 2000 Identification of a novel gene with RING-H2 finger motif induced after chronic antidepressant treatment in rat brain.
More...