Property Summary

NCBI Gene PubMed Count 87
PubMed Score 26.17
PubTator Score 37.06

Knowledge Summary

Patent

No data available

Expression

Protein-protein Interaction (4)

Gene RIF (64)

AA Sequence

MSDEEARQSGGSSQAGVVTVSDVQELMRRKEEIEAQIKANYDVLESQKGIGMNEPLVDCEGYPRSDVDLY      1 - 70
QVRTARHNIICLQNDHKAVMKQVEEALHQLHARDKEKQARDMAEAHKEAMSRKLGQSESQGPPRAFAKVN     71 - 140
SISPGSPASIAGLQVDDEIVEFGSVNTQNFQSLHNIGSVVQHSEGKPLNVTVIRRGEKHQLRLVPTRWAG    141 - 210
KGLLGCNIIPLQR                                                             211 - 223
//

Text Mined References (90)

PMID Year Title