Property Summary

NCBI Gene PubMed Count 87
PubMed Score 26.17
PubTator Score 37.06

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession O00233 B2RD35 G3V1Q6 Q9BQ42
Symbols p27
Rpn4

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Macaque OMA EggNOG Inparanoid

Protein-protein Interaction (4)

Gene RIF (64)

AA Sequence

MSDEEARQSGGSSQAGVVTVSDVQELMRRKEEIEAQIKANYDVLESQKGIGMNEPLVDCEGYPRSDVDLY      1 - 70
QVRTARHNIICLQNDHKAVMKQVEEALHQLHARDKEKQARDMAEAHKEAMSRKLGQSESQGPPRAFAKVN     71 - 140
SISPGSPASIAGLQVDDEIVEFGSVNTQNFQSLHNIGSVVQHSEGKPLNVTVIRRGEKHQLRLVPTRWAG    141 - 210
KGLLGCNIIPLQR                                                             211 - 223
//

Text Mined References (90)

PMID Year Title