Property Summary

NCBI Gene PubMed Count 83
Grant Count 2
R01 Count 1
Funding $231,166.62
PubMed Score 25.65
PubTator Score 37.06

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession O00233 B2RD35 G3V1Q6 Q9BQ42
Symbols p27
Rpn4

Gene

PANTHER Protein Class (1)

 Grant Application (2)

Gene RIF (63)

PMID Text
26624926 Studies have found significant associations of the treatment response with the 26S proteasome non-ATPase subunit 9 (PSMD9), proteasome alpha type 7 subunit (PSMA7) and PSMD13 genes.
26191286 recurrence rate of p27 and/or PTEN-negative patients was higher than that of the positive ones,that should be followed up closely after treatment
26166263 The PSMD9 intronic SNPs rs74421874 (IVS3+nt460 G>A) and rs3825172 (IVS3+nt437 C>T) remain significantly associated with insomnia only when taking into account anxiety -and not depression- as covariate.
25545366 The present study provided the first evidences that miR-1470 mediated lapatinib induced p27 upregulation by targeting c-jun.
24852133 Staining intensities of cell cycle inhibitors p27 and p57 significantly increased in all parts of preeclamptic placentas compared to control
24673853 PSMD9 expression predicts radiotherapy response in breast cancer.
24648162 Describe PSMD9 gene SNPs in linkage to generalized anxiety disorder in type 2 diabetic families.
23689538 Our results suggest that tuberin and p27 are aberrantly expressed in malignant breast tissue
23618860 Surprisingly, we found that GRP/GRP-R differentially induced expressions of p21 and p27. Silencing GRP/GRP-R decreased p21, but it increased p27 expressions in neuroblastoma cells.
23464457 Expression of Hath1, Muc2, cyclin D1 and p27 in the xenograft tumors was also detected.
More...

AA Sequence

MSDEEARQSGGSSQAGVVTVSDVQELMRRKEEIEAQIKANYDVLESQKGIGMNEPLVDCEGYPRSDVDLY      1 - 70
QVRTARHNIICLQNDHKAVMKQVEEALHQLHARDKEKQARDMAEAHKEAMSRKLGQSESQGPPRAFAKVN     71 - 140
SISPGSPASIAGLQVDDEIVEFGSVNTQNFQSLHNIGSVVQHSEGKPLNVTVIRRGEKHQLRLVPTRWAG    141 - 210
KGLLGCNIIPLQR                                                             211 - 223
//

Text Mined References (86)

PMID Year Title
26624926 2015 Proteasome system dysregulation and treatment resistance mechanisms in major depressive disorder.
26191286 2015 Expression of p27 and PTEN and clinical characteristics in early laryngeal squamous cell carcinoma and their correlation with recurrence.
26166263 2015 T2D and Depression Risk Gene Proteasome Modulator 9 is Linked to Insomnia.
25545366 2015 miR-1470 mediates lapatinib induced p27 upregulation by targeting c-jun.
25416956 2014 A proteome-scale map of the human interactome network.
24852133 2014 The expression of cell cycle related proteins PCNA, Ki67, p27 and p57 in normal and preeclamptic human placentas.
24673853 2014 PSMD9 expression predicts radiotherapy response in breast cancer.
24648162 2014 Proteasome modulator 9 gene SNPs, responsible for anti-depressant response, are in linkage with generalized anxiety disorder.
24586186 2014 Genome-wide association study of metabolic traits reveals novel gene-metabolite-disease links.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
More...