Property Summary

NCBI Gene PubMed Count 46
PubMed Score 9.21
PubTator Score 4.09

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (10)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.200 1.1e-05
invasive ductal carcinoma 1.200 9.5e-03
lung cancer 1.100 1.0e-02
Multiple myeloma 1.390 1.8e-02
non-small cell lung cancer 1.038 2.1e-18
osteosarcoma 1.043 1.2e-02
ovarian cancer -1.600 5.0e-04
pancreatic ductal adenocarcinoma liver m... -1.296 1.3e-02
Parkinson's disease -1.100 3.1e-02
psoriasis 1.300 3.6e-04

Gene RIF (26)

AA Sequence

MADGGSERADGRIVKMEVDYSATVDQRLPECAKLAKEGRLQEVIETLLSLEKQTRTASDMVSTSRILVAV      1 - 70
VKMCYEAKEWDLLNENIMLLSKRRSQLKQAVAKMVQQCCTYVEEITDLPIKLRLIDTLRMVTEGKIYVEI     71 - 140
ERARLTKTLATIKEQNGDVKEAASILQELQVETYGSMEKKERVEFILEQMRLCLAVKDYIRTQIISKKIN    141 - 210
TKFFQEENTEKLKLKYYNLMIQLDQHEGSYLSICKHYRAIYDTPCIQAESEKWQQALKSVVLYVILAPFD    211 - 280
NEQSDLVHRISGDKKLEEIPKYKDLLKLFTTMELMRWSTLVEDYGMELRKGSLESPATDVFGSTEEGEKR    281 - 350
WKDLKNRVVEHNIRIMAKYYTRITMKRMAQLLDLSVDESEAFLSNLVVNKTIFAKVDRLAGIINFQRPKD    351 - 420
PNNLLNDWSQKLNSLMSLVNKTTHLIAKEEMIHNLQ                                      421 - 456
//

Text Mined References (57)

PMID Year Title