Property Summary

NCBI Gene PubMed Count 23
PubMed Score 1216.02
PubTator Score 323.41

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

Synonym

Accession O00230 Q5T6G0 Q6UX11
Symbols CST-14
CST-17
CST-29

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA Inparanoid

Gene RIF (14)

AA Sequence

MPLSPGLLLLLLSGATATAALPLEGGPTGRDSEHMQEAAGIRKSSLLTFLAWWFEWTSQASAGPLIGEEA      1 - 70
REVARRQEGAPPQQSARRDRMPCRNFFWKTFSSCK                                        71 - 105
//

Text Mined References (25)

PMID Year Title