Property Summary

NCBI Gene PubMed Count 22
Grant Count 412
R01 Count 183
Funding $86,085,861.06
PubMed Score 1133.55
PubTator Score 323.41

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Expression

Synonym

Accession O00230 Q5T6G0 Q6UX11
Symbols CST-14
CST-17
CST-29

Gene

Gene RIF (13)

PMID Text
23595952 Cortistatin emerges as a natural endogenous regulator of smooth muscle cells under pathological conditions and an attractive candidate for the pharmacological management of vascular diseases that course with neointimal lesion formation.
20398908 Observational study of gene-disease association. (HuGE Navigator)
20164562 The cortistatin expression in the temporal lobe of Alzheimer's disease patients is decressed.
19086053 Observational study of gene-disease association. (HuGE Navigator)
18709137 A lower expression of CST exists in diabetic retinas and it is associated with retinal neurodegeneration.
18450367 Human immune cells produce CST, whereas macrophage lineage and activated endothelium express sst2, and human lymphocytes express sst3. The human thymus expresses sst1, 2, 3, MrgX2 and almost all immune cells express GHS-R. [review]
16043736 Intravitreous somatostatin-like immunoreactivity deficit occurs in ptients with proliferative diabetic retinopathy.
14669820 Cortistatin plays a role in the auto/paracrine regulation of the endocrine pancreas
12915402 cortistatin-14 shown to be a high affinity ligand for G protein coupled receptor MrgX2 which is expressed in dorsal root ganglion
12684217 study demonstrates for the first time a selective and inducible expression of the recently discovered cortistatin, as well as somatostatin receptor 2, in human monocyte-derived cells
More...

AA Sequence

MPLSPGLLLLLLSGATATAALPLEGGPTGRDSEHMQEAAGIRKSSLLTFLAWWFEWTSQASAGPLIGEEA      1 - 70
REVARRQEGAPPQQSARRDRMPCRNFFWKTFSSCK                                        71 - 105
//

Text Mined References (24)

PMID Year Title
23595952 2013 Cortistatin inhibits migration and proliferation of human vascular smooth muscle cells and decreases neointimal formation on carotid artery ligation.
20398908 2010 Comprehensive copy number variant (CNV) analysis of neuronal pathways genes in psychiatric disorders identifies rare variants within patients.
20164562 2010 Expression of Somatostatin, cortistatin, and their receptors, as well as dopamine receptors, but not of neprilysin, are reduced in the temporal lobe of Alzheimer's disease patients.
19086053 2009 Identification of new putative susceptibility genes for several psychiatric disorders by association analysis of regulatory and non-synonymous SNPs of 306 genes involved in neurotransmission and neurodevelopment.
18709137 2008 Lowered cortistatin expression is an early event in the human diabetic retina and is associated with apoptosis and glial activation.
18450367 2008 The role of cortistatin in the human immune system.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16043736 2005 Somatostatin molecular variants in the vitreous fluid: a comparative study between diabetic patients with proliferative diabetic retinopathy and nondiabetic control subjects.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14669820 2003 Presence of cortistatin in the human pancreas.
More...