Property Summary

NCBI Gene PubMed Count 37
Grant Count 25
R01 Count 19
Funding $1,870,215.13
PubMed Score 88.21
PubTator Score 22.76

Knowledge Summary

Patent (7,349)

Expression

  Differential Expression (4)

Disease log2 FC p
group 4 medulloblastoma 3.800 0.000
medulloblastoma, large-cell 1.100 0.016
lung cancer 4.700 0.000
lung carcinoma 1.300 0.000

MLP Assay (3)

AID Type Active / Inconclusive / Inactive Description
743425 confirmatory 21 / 0 / 2 Modulation of the Metabotropic Glutamate Receptors mGlu7 and mGlu8: Potency at rat mGlu8/calcium
743447 confirmatory 1 / 0 / 0 Fold shift mGlu8 using GIRK assay
743462 confirmatory 1 / 0 / 0 Modulation of the Metabotropic Glutamate Receptors mGlu7and mGlu8:Potency at rat mGlu8/GIRK (Confirmatory)

Gene RIF (26)

PMID Text
26655190 Study represents a genetic association test towards single variant and multi-markers interaction of GRM7 and GRM8 genes in both schizophrenia and major depressive disorders in Han Chinese population
25978827 These results further implicate the role of glutamate receptor genes such as GRM8 in the development of alcohol dependence.
25918841 Genome wide association study and meta-analysis results detected rs6951643, a GRM8 genetic variant as suggestive marker for sporadic Creutzfeldt-Jakob disease risk mapping outside the PRNP region.
25588301 The GRM8 gene might play an important role in the pathogenesis of schizophrenia.
24821406 propose three potential human candidate genes for voluntary physical exercise levels (MC3R, CYP24A1, and GRM8).
23420844 Glutamate acts as a partial inverse agonist to metabotropic glutamate receptor with a single amino acid mutation in the transmembrane domain
21493956 Eight suggestive significant loci were detected with a series of genes expressed within the inner ear that underlie the auditory function, such as: DCLK1, PTPRD, GRM8, CMIP.
20560679 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20398908 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
More...

AA Sequence

MVCEGKRSASCPCFFLLTAKFYWILTMMQRTHSQEYAHSIRVDGDIILGGLFPVHAKGERGVPCGELKKE      1 - 70
KGIHRLEAMLYAIDQINKDPDLLSNITLGVRILDTCSRDTYALEQSLTFVQALIEKDASDVKCANGDPPI     71 - 140
FTKPDKISGVIGAAASSVSIMVANILRLFKIPQISYASTAPELSDNTRYDFFSRVVPPDSYQAQAMVDIV    141 - 210
TALGWNYVSTLASEGNYGESGVEAFTQISREIGGVCIAQSQKIPREPRPGEFEKIIKRLLETPNARAVIM    211 - 280
FANEDDIRRILEAAKKLNQSGHFLWIGSDSWGSKIAPVYQQEEIAEGAVTILPKRASIDGFDRYFRSRTL    281 - 350
ANNRRNVWFAEFWEENFGCKLGSHGKRNSHIKKCTGLERIARDSSYEQEGKVQFVIDAVYSMAYALHNMH    351 - 420
KDLCPGYIGLCPRMSTIDGKELLGYIRAVNFNGSAGTPVTFNENGDAPGRYDIFQYQITNKSTEYKVIGH    421 - 490
WTNQLHLKVEDMQWAHREHTHPASVCSLPCKPGERKKTVKGVPCCWHCERCEGYNYQVDELSCELCPLDQ    491 - 560
RPNMNRTGCQLIPIIKLEWHSPWAVVPVFVAILGIIATTFVIVTFVRYNDTPIVRASGRELSYVLLTGIF    561 - 630
LCYSITFLMIAAPDTIICSFRRVFLGLGMCFSYAALLTKTNRIHRIFEQGKKSVTAPKFISPASQLVITF    631 - 700
SLISVQLLGVFVWFVVDPPHIIIDYGEQRTLDPEKARGVLKCDISDLSLICSLGYSILLMVTCTVYAIKT    701 - 770
RGVPETFNEAKPIGFTMYTTCIIWLAFIPIFFGTAQSAEKMYIQTTTLTVSMSLSASVSLGMLYMPKVYI    771 - 840
IIFHPEQNVQKRKRSFKAVVTAATMQSKLIQKGNDRPNGEVKSELCESLETNTSSTKTTYISYSNHSI      841 - 908
//

Text Mined References (38)

PMID Year Title
26655190 2016 Significant association of GRM7 and GRM8 genes with schizophrenia and major depressive disorder in the Han Chinese population.
25978827 2015 Further Analyses of Genetic Association Between GRM8 and Alcohol Dependence Symptoms Among Young Adults.
25918841 2014 A genome wide association study links glutamate receptor pathway to sporadic Creutzfeldt-Jakob disease risk.
25588301 2014 Association analysis of the GRM8 gene with schizophrenia in the Uygur Chinese population.
25060954 2014 Salt-inducible kinase 3, SIK3, is a new gene associated with hearing.
24821406 2015 A candidate syntenic genetic locus is associated with voluntary exercise levels in mice and humans.
23420844 2013 Glutamate acts as a partial inverse agonist to metabotropic glutamate receptor with a single amino acid mutation in the transmembrane domain.
21493956 2011 Hearing function and thresholds: a genome-wide association study in European isolated populations identifies new loci and pathways.
20800221 2010 Genome-wide association scan of trait depression.
20560679 2010 Response to methadone maintenance treatment is associated with the MYOCD and GRM6 genes.
More...