Property Summary

NCBI Gene PubMed Count 205
Grant Count 386
R01 Count 226
Funding $36,869,432.89
PubMed Score 2630.60
PubTator Score 404.93

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession O00220 A8K5I4 Q53Y72 Q96E62
Symbols DR4
APO2
CD261
TRAILR1
TRAILR-1

Gene

Gene RIF (188)

PMID Text
26718429 TRAIL genetic polymorphisms do not contribute, but DR4 polymorphisms may contribute to susceptibility to head and neck cancer in Pakistani population.
26708505 LOC389641 promotes pancreatic ductal adenocarcinoma progression and increases cell invasion by regulating E-cadherin with the possible involvement of TNFRSF10A.
26561202 Bee venom inhibits colon cancer cell growth, and these anti-proliferative effects may be related to the induction of apoptosis by activation of DR4 and DR5 and inhibition of NF-kappaB activity.
26518902 Study investigated the association between colorectal cancer and polymorphisms in TRAIL and DR4 gene in Pakistani patients; TRAIL gene 1595 C>T genotypes percentage in colorectal cancer patients was statistically non-significant; for DR4 A1322G, homozygous GG genotype was 36% in the patients and in controls: there was statistically insignificant difference (p> 0.05).
26457518 The structure of death receptor 4 (DR4) in complex with TNF-related apoptosis-inducing ligand (TRAIL) has been determined at 3 A resolution and compared with those of previously determined DR5-TRAIL complexes.
26418999 The rs13278062 polymorphism of the DR4 gene not only can confer an increased risk for crohn disease, but may also influence the location of the lesions and the disease behaviors.
26315998 These statistical data suggest that Thr209Arg in exon 4 of the TRAIL-R1 gene may not represent a modifier of susceptibility to cancer.
26297860 study involving a relatively large sample size showed that TNFRSF10 eQTL SNPs within lncRNAs might influence both hepatocellular carcinoma development and HBV infection
26275133 GRS using ARMS2, CFH, TNFRSF10A, VEGFA, and CFI was significantly associated with second-eye involvement. Genetic risk has high predictive ability for second-eye involvement of AMD.
26238205 Results showed DR4 promotor methylation and low protein expression level in patients with lung squamous carcinoma which correlated with the prognosis of the disease.
More...

AA Sequence

MAPPPARVHLGAFLAVTPNPGSAASGTEAAAATPSKVWGSSAGRIEPRGGGRGALPTSMGQHGPSARARA      1 - 70
GRAPGPRPAREASPRLRVHKTFKFVVVGVLLQVVPSSAATIKLHDQSIGTQQWEHSPLGELCPPGSHRSE     71 - 140
HPGACNRCTEGVGYTNASNNLFACLPCTACKSDEEERSPCTTTRNTACQCKPGTFRNDNSAEMCRKCSRG    141 - 210
CPRGMVKVKDCTPWSDIECVHKESGNGHNIWVILVVTLVVPLLLVAVLIVCCCIGSGCGGDPKCMDRVCF    211 - 280
WRLGLLRGPGAEDNAHNEILSNADSLSTFVSEQQMESQEPADLTGVTVQSPGEAQCLLGPAEAEGSQRRR    281 - 350
LLVPANGADPTETLMLFFDKFANIVPFDSWDQLMRQLDLTKNEIDVVRAGTAGPGDALYAMLMKWVNKTG    351 - 420
RNASIHTLLDALERMEERHAREKIQDLLVDSGKFIYLEDGTGSAVSLE                          421 - 468
//

Text Mined References (210)

PMID Year Title
26718429 2015 Genetic variants in the tumor Necrosis Factor-Related Apoptosis-Inducing Ligand (TRAIL) do not contribute but Death Receptor (DR4) genes may contribute to susceptibility to head and neck cancer in Pakistani population.
26708505 2016 Long non-coding RNA LOC389641 promotes progression of pancreatic ductal adenocarcinoma and increases cell invasion by regulating E-cadherin in a TNFRSF10A-related manner.
26561202 2015 Anti-cancer effect of bee venom on colon cancer cell growth by activation of death receptors and inhibition of nuclear factor kappa B.
26518902 2015 Genetic variants in the tumor necrosis factor-related apoptosis-inducing ligand (TRAIL) and death receptor (DR4) genes contribute to susceptibility to colorectal cancer in pakistani population.
26457518 2015 The structure of the death receptor 4-TNF-related apoptosis-inducing ligand (DR4-TRAIL) complex.
26418999 2015 [Associations of Crohn's disease with DR4 and DR5 gene polymorphisms].
26315998 2015 Genetic association between TRAIL-R1 Thr209Arg and cancer susceptibility.
26297860 2016 Expression quantitative trait loci for TNFRSF10 influence both HBV infection and hepatocellular carcinoma development.
26275133 2015 The Contribution of Genetic Architecture to the 10-Year Incidence of Age-Related Macular Degeneration in the Fellow Eye.
26238205 2015 Effect of DR4 promoter methylation on the TRAIL-induced apoptosis in lung squamous carcinoma cell.
More...