Property Summary

Ligand Count 1
NCBI Gene PubMed Count 213
PubMed Score 2664.15
PubTator Score 404.93

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Macular degeneration 65 0.0 3.0

Expression

Gene RIF (195)

AA Sequence

MAPPPARVHLGAFLAVTPNPGSAASGTEAAAATPSKVWGSSAGRIEPRGGGRGALPTSMGQHGPSARARA      1 - 70
GRAPGPRPAREASPRLRVHKTFKFVVVGVLLQVVPSSAATIKLHDQSIGTQQWEHSPLGELCPPGSHRSE     71 - 140
HPGACNRCTEGVGYTNASNNLFACLPCTACKSDEEERSPCTTTRNTACQCKPGTFRNDNSAEMCRKCSRG    141 - 210
CPRGMVKVKDCTPWSDIECVHKESGNGHNIWVILVVTLVVPLLLVAVLIVCCCIGSGCGGDPKCMDRVCF    211 - 280
WRLGLLRGPGAEDNAHNEILSNADSLSTFVSEQQMESQEPADLTGVTVQSPGEAQCLLGPAEAEGSQRRR    281 - 350
LLVPANGADPTETLMLFFDKFANIVPFDSWDQLMRQLDLTKNEIDVVRAGTAGPGDALYAMLMKWVNKTG    351 - 420
RNASIHTLLDALERMEERHAREKIQDLLVDSGKFIYLEDGTGSAVSLE                          421 - 468
//

Text Mined References (218)

PMID Year Title