Property Summary

NCBI Gene PubMed Count 36
PubMed Score 28.30
PubTator Score 137.77

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
Atopic dermatitis 2.500 3.1e-04
atypical teratoid / rhabdoid tumor 2.200 7.1e-03
Breast cancer -3.700 2.7e-70
breast carcinoma -1.600 1.8e-14
cystic fibrosis 3.000 2.1e-05
group 3 medulloblastoma 3.600 2.3e-05
interstitial cystitis -1.900 3.5e-02
intraductal papillary-mucinous neoplasm ... 2.100 3.2e-04
osteosarcoma -5.608 1.7e-16
pancreatic cancer 1.200 5.7e-03
primary pancreatic ductal adenocarcinoma 1.473 9.3e-03
primitive neuroectodermal tumor 1.600 7.2e-03
psoriasis 2.500 2.6e-38

Gene RIF (26)

AA Sequence

MPVQLTTALRVVGTSLFALAVLGGILAAYVTGYQFIHTEKHYLSFGLYGAILGLHLLIQSLFAFLEHRRM      1 - 70
RRAGQALKLPSPRRGSVALCIAAYQEDPDYLRKCLRSAQRISFPDLKVVMVVDGNRQEDAYMLDIFHEVL     71 - 140
GGTEQAGFFVWRSNFHEAGEGETEASLQEGMDRVRDVVRASTFSCIMQKWGGKREVMYTAFKALGDSVDY    141 - 210
IQVCDSDTVLDPACTIEMLRVLEEDPQVGGVGGDVQILNKYDSWISFLSSVRYWMAFNVERACQSYFGCV    211 - 280
QCISGPLGMYRNSLLQQFLEDWYHQKFLGSKCSFGDDRHLTNRVLSLGYRTKYTARSKCLTETPTKYLRW    281 - 350
LNQQTRWSKSYFREWLYNSLWFHKHHLWMTYESVVTGFFPFFLIATVIQLFYRGRIWNILLFLLTVQLVG    351 - 420
IIKATYACFLRGNAEMIFMSLYSLLYMSSLLPAKIFAIATINKSGWGTSGRKTIVVNFIGLIPVSIWVAV    421 - 490
LLGGLAYTAYCQDLFSETELAFLVSGAILYGCYWVALLMLYLAIIARRCGKKPEQYSLAFAEV           491 - 553
//

Text Mined References (39)

PMID Year Title