Property Summary

NCBI Gene PubMed Count 34
PubMed Score 26.72
PubTator Score 137.77

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
psoriasis 6685 1.44995313240746E-166
Breast cancer 3099 2.67711479134434E-70
osteosarcoma 7933 1.69211512514903E-16
breast carcinoma 1614 1.84702153504566E-14
cystic fibrosis 1670 2.10790209563894E-5
group 3 medulloblastoma 2254 2.33821441396984E-5
interstitial cystitis 2299 1.94820635888918E-4
Atopic dermatitis 944 3.13155185578211E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 3.17143248434374E-4
pancreatic cancer 2300 0.00573369410004758
atypical teratoid / rhabdoid tumor 4369 0.00707772220134547
primitive neuroectodermal tumor 3031 0.00720507972262177
primary pancreatic ductal adenocarcinoma 1271 0.00934778195912434
Disease Target Count Z-score Confidence
Attention deficit hyperactivity disorder 156 0.0 1.0
Disease Target Count Z-score Confidence
Skin atrophy 13 3.027 1.5

Expression

  Differential Expression (13)

Synonym

Accession O00219 A8K5T5 Q8WTZ0 Q9NYP0
Symbols

Gene

  Ortholog (10)

Gene RIF (24)

PMID Text
26222208 Overexpression of HAS3 decreased ERK1/2 phosphorylation suggesting that inhibition of MAP-kinase signaling was responsible for decreased melanoma cell adhesion, migration and proliferation.
25934334 HAS3 underexpression is associated with advanced tumor stage and adverse pathological features, as well as implies inferior clinical outcomes for both groups of patients with UTUCs and UBUCs, suggesting its critical role in tumor progression
25843802 Transcriptional factor binding analysis indicated that HAS3 gene promoter lacks of canonical TATA box, but contains classical GC box as well as other putative binding sites for transcriptional factors
25147816 Hyaluronan accumulation by HAS3 favors pancreatic cancer growth.
24658508 HAS3 mRNA expression level increases in atopic dermatitis lesions compared with healthy and non-lesional skin
24509846 Rab10 silencing increased the plasma membrane residence of HAS3, resulting in a significant increase of hyaluronan secretion and an enlarged cell surface HA coat, whereas Rab10 overexpression suppressed hyaluronan synthesis.
24470002 Hyaluronan (HA) produced by HAS3 is a ubiquitous component of the extracellular matrix and plays an active role in tissue remodeling. In addition, HA is known to reduce reactive oxygen species (ROS) -induced cardiac injury.
23979132 Data indicate that oxLDL doubled the transcripts of hyaluronan synthases HAS2 and HAS3 and hyaluronan deposition via the scavenger receptor LOX-1.
23560496 Inverse expression of hyaluronidase 2 and hyaluronan synthases 1-3 is associated with reduced hyaluronan content in malignant cutaneous melanoma.
23303191 Hyaluronan synthase 1 (HAS1) requires higher cellular UDP-GlcNAc concentration than HAS2 and HAS3
More...

AA Sequence

MPVQLTTALRVVGTSLFALAVLGGILAAYVTGYQFIHTEKHYLSFGLYGAILGLHLLIQSLFAFLEHRRM      1 - 70
RRAGQALKLPSPRRGSVALCIAAYQEDPDYLRKCLRSAQRISFPDLKVVMVVDGNRQEDAYMLDIFHEVL     71 - 140
GGTEQAGFFVWRSNFHEAGEGETEASLQEGMDRVRDVVRASTFSCIMQKWGGKREVMYTAFKALGDSVDY    141 - 210
IQVCDSDTVLDPACTIEMLRVLEEDPQVGGVGGDVQILNKYDSWISFLSSVRYWMAFNVERACQSYFGCV    211 - 280
QCISGPLGMYRNSLLQQFLEDWYHQKFLGSKCSFGDDRHLTNRVLSLGYRTKYTARSKCLTETPTKYLRW    281 - 350
LNQQTRWSKSYFREWLYNSLWFHKHHLWMTYESVVTGFFPFFLIATVIQLFYRGRIWNILLFLLTVQLVG    351 - 420
IIKATYACFLRGNAEMIFMSLYSLLYMSSLLPAKIFAIATINKSGWGTSGRKTIVVNFIGLIPVSIWVAV    421 - 490
LLGGLAYTAYCQDLFSETELAFLVSGAILYGCYWVALLMLYLAIIARRCGKKPEQYSLAFAEV           491 - 553
//

Text Mined References (37)

PMID Year Title
26222208 2015 Hyaluronan synthase 3 (HAS3) overexpression downregulates MV3 melanoma cell proliferation, migration and adhesion.
25934334 2015 HAS3 underexpression as an indicator of poor prognosis in patients with urothelial carcinoma of the upper urinary tract and urinary bladder.
25843802 2015 Identification and analysis of the promoter region of the human HAS3 gene.
25147816 2014 Accumulation of extracellular hyaluronan by hyaluronan synthase 3 promotes tumor growth and modulates the pancreatic cancer microenvironment.
24658508 2014 Hyaluronan metabolism in human keratinocytes and atopic dermatitis skin is driven by a balance of hyaluronan synthases 1 and 3.
24509846 2014 Rab10-mediated endocytosis of the hyaluronan synthase HAS3 regulates hyaluronan synthesis and cell adhesion to collagen.
24470002 2014 Hyaluronan synthase 3 variant and anthracycline-related cardiomyopathy: a report from the children's oncology group.
23979132 2013 Oxidized low density lipoprotein (LDL) affects hyaluronan synthesis in human aortic smooth muscle cells.
23560496 2013 Inverse expression of hyaluronidase 2 and hyaluronan synthases 1-3 is associated with reduced hyaluronan content in malignant cutaneous melanoma.
23303191 2013 Hyaluronan synthase 1 (HAS1) requires higher cellular UDP-GlcNAc concentration than HAS2 and HAS3.
More...