Property Summary

NCBI Gene PubMed Count 23
Grant Count 4
R01 Count 4
Funding $475,033.67
PubMed Score 22.86
PubTator Score 16.93

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
Multiple myeloma 1.205 0.004
astrocytic glioma 2.300 0.008
ependymoma 2.400 0.008
oligodendroglioma 2.400 0.004
osteosarcoma 1.390 0.000
pancreatic ductal adenocarcinoma liver m... 1.558 0.013
intraductal papillary-mucinous carcinoma... 1.200 0.005
non primary Sjogren syndrome sicca 1.300 0.033
lung adenocarcinoma 1.300 0.000
Pick disease 1.200 0.000
ovarian cancer 3.400 0.000

Synonym

Accession O00217 B2RB86 Q0VDA8
Symbols TYKY
CI-23k
CI23KD

Gene

PANTHER Protein Class (2)

Gene RIF (7)

PMID Text
22190034 HIV-1 Vpr is identified to have a physical interaction with NADH dehydrogenase (ubiquinone) Fe-S protein 8 (NDUFS8) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
20877624 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19343046 Observational study of gene-disease association. (HuGE Navigator)
18977241 Observational study of gene-disease association. (HuGE Navigator)
17601350 Observational study of gene-disease association. (HuGE Navigator)
15159508 2 new mutations (P85L upstream from the 2 cysteine motifs that coordinate the two [4Fe-4S] clusters which generate the complex I N2 clusters, & R138H between them)suggest that this subunit is essential for either the assembly or stability of complex I.

AA Sequence

MRCLTTPMLLRALAQAARAGPPGGRSLHSSAVAATYKYVNMQDPEMDMKSVTDRAARTLLWTELFRGLGM      1 - 70
TLSYLFREPATINYPFEKGPLSPRFRGEHALRRYPSGEERCIACKLCEAICPAQAITIEAEPRADGSRRT     71 - 140
TRYDIDMTKCIYCGFCQEACPVDAIVEGPNFEFSTETHEELLYNKEKLLNNGDKWEAEIAANIQADYLYR    141 - 210
//

Text Mined References (25)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19343046 2009 Association study between single-nucleotide polymorphisms in 199 drug-related genes and commonly measured quantitative traits of 752 healthy Japanese subjects.
18977241 2008 Oxidative stress, telomere length and biomarkers of physical aging in a cohort aged 79 years from the 1932 Scottish Mental Survey.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17601350 2007 A genetic association analysis of cognitive ability and cognitive ageing using 325 markers for 109 genes associated with oxidative stress or cognition.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...