Property Summary

NCBI Gene PubMed Count 64
PubMed Score 118.91
PubTator Score 110.36

Knowledge Summary


No data available


  Disease Sources (2)

Disease Target Count P-value
breast carcinoma 1614 7.54885679589684E-24
ovarian cancer 8492 2.8367988756609E-12
juvenile dermatomyositis 1189 5.61842512553102E-12
non-small cell lung cancer 2798 2.52110521177552E-10
osteosarcoma 7933 4.69673965481811E-8
psoriasis 6685 7.32040501640677E-8
atypical teratoid / rhabdoid tumor 4369 8.18375524993575E-7
medulloblastoma, large-cell 6234 4.03289935554348E-5
pituitary cancer 1972 4.52446923137346E-5
Pick disease 1893 4.58232000530288E-5
cystic fibrosis 1670 1.41808497016839E-4
lung adenocarcinoma 2714 2.19564133066576E-4
medulloblastoma 1524 3.31307647602191E-4
adult high grade glioma 2148 0.00121823077398275
lung cancer 4473 0.00126226085700906
tuberculosis and treatment for 3 months 327 0.001361591289756
Rheumatoid Arthritis 1171 0.00144702445830335
invasive ductal carcinoma 2950 0.00362538872518133
non-inflammatory breast cancer 208 0.0120939055152733
astrocytic glioma 2241 0.0124305060683339
ductal carcinoma in situ 1745 0.013769138814278
oligodendroglioma 2849 0.017477749913489
ependymoma 2514 0.023470544843297
primitive neuroectodermal tumor 3031 0.0352495115176293
Disease Target Count Z-score Confidence
Cholesteatoma 13 3.467 1.7


  Differential Expression (24)

Disease log2 FC p
Rheumatoid Arthritis 1.400 0.001
astrocytic glioma -1.900 0.012
ependymoma -1.800 0.023
oligodendroglioma -2.100 0.017
psoriasis 1.800 0.000
osteosarcoma -2.506 0.000
atypical teratoid / rhabdoid tumor -1.700 0.000
medulloblastoma -1.300 0.000
medulloblastoma, large-cell -1.700 0.000
primitive neuroectodermal tumor -1.200 0.035
juvenile dermatomyositis 1.157 0.000
tuberculosis and treatment for 3 months -1.200 0.001
non-small cell lung cancer 1.353 0.000
lung cancer 1.500 0.001
cystic fibrosis -1.100 0.000
adult high grade glioma -1.300 0.001
lung adenocarcinoma 1.079 0.000
non-inflammatory breast cancer 1.200 0.012
breast carcinoma 1.500 0.000
Pick disease -1.500 0.000
ductal carcinoma in situ 1.200 0.014
invasive ductal carcinoma 2.500 0.004
ovarian cancer -4.600 0.000
pituitary cancer -1.100 0.000


Accession O00214 O15215 Q5T3P5 Q5T3Q4 Q8TEV1 Q96B92 Q9BXC8 Q9H584 Q9H585 Q9UEZ6 Q9UP32 Q9UP33 Q9UP34 Gal-8
Symbols Gal-8


PANTHER Protein Class (1)


2YRO   2YV8   2YXS   3AP4   3AP5   3AP6   3AP7   3AP9   3APB   3OJB   3VKL   3VKM   3VKN   3VKO   4BMB   4BME   4FQZ   4GXL   4HAN  

  Ortholog (9)

Gene RIF (43)

27066737 this study uncovers a unique molecular mechanism of lymphangiogenesis in which galectin-8-dependent crosstalk among VEGF-C, podoplanin and integrin pathways plays a key role.
25800007 Platelet-derived factor V/Va is generated following endocytosis of the plasma-derived molecule by the platelet precursor cells, megakaryocytes, via a two receptor system consisting of LRP-1 and an unidentified specific "binding site".
25573487 The fundamental roles of galectin-8 in human anaplastic large cell lymphoma
25499921 Gal-8 expression is a potential independent unfavorable prognostic indicator for postoperative recurrence of patients with localized pT1 clear cell renal cell carcinoma
24957054 these results not only confirm the pro-inflammatory role we have already proposed for Gal-8 in other cellular systems but also suggest that this lectin is orchestrating the interaction between leukocytes, platelets and endothelial cells
24939370 The implications of gal-8 in tumor angiogenesis remain to be further explored, but it is exciting to speculate that modulating gal-8-glycan interactions could be used to block lymphatic-vascular connections vital for metastasis
24788652 Whereas Galectin (Gal)-1, -3, and -8 triggered vascular endothelial growth factor (VEGF) release, only Gal-8 induced endostatin secretion.
24696431 We integrate here the available information on Gal-8 expression in different tumor types and attempt to elucidate associations of its expression and localization with tumor progression[review]
24418318 Focusing on the F19Y change in galectin-8, we study of consequences of a single-site substitution in the carbohydrate recognition domain of this family of cellular effectors.
23555773 analysis of how human Galectin-8C domain interacts with its glycan ligands

AA Sequence

AVNGVHSLEYKHRFKELSSIDTLEINGDIHLLEVRSW                                     281 - 317

Text Mined References (65)

PMID Year Title
27066737 2016 Pathological lymphangiogenesis is modulated by galectin-8-dependent crosstalk between podoplanin and integrin-associated VEGFR-3.
25800007 2015 Mechanisms Regulating Acquisition of Platelet-Derived Factor V/Va by Megakaryocytes.
25573487 2015 Sialylation by ?-galactoside ?-2,6-sialyltransferase and N-glycans regulate cell adhesion and invasion in human anaplastic large cell lymphoma.
25499921 2015 Galectin-8 predicts postoperative recurrence of patients with localized T1 clear cell renal cell carcinoma.
25416956 2014 A proteome-scale map of the human interactome network.
24957054 2014 Galectin-8 elicits pro-inflammatory activities in the endothelium.
24939370 2014 Galectin-8: a matricellular lectin with key roles in angiogenesis.
24788652 2014 Control of angiogenesis by galectins involves the release of platelet-derived proangiogenic factors.
24696431 2014 Expression, localization and function of galectin-8, a tandem-repeat lectin, in human tumors.
24418318 2014 Natural single amino acid polymorphism (F19Y) in human galectin-8: detection of structural alterations and increased growth-regulatory activity on tumor cells.