Property Summary

Ligand Count 3
NCBI Gene PubMed Count 69
PubMed Score 130.41
PubTator Score 110.36

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
adult high grade glioma -1.300 1.2e-03
astrocytic glioma -1.900 1.2e-02
atypical teratoid / rhabdoid tumor -1.700 8.2e-07
Breast cancer 1.100 1.1e-06
breast carcinoma 1.100 4.4e-22
cystic fibrosis -1.100 1.4e-04
ductal carcinoma in situ 1.200 1.4e-02
ependymoma -1.800 2.3e-02
group 4 medulloblastoma -1.100 9.0e-03
invasive ductal carcinoma 1.500 2.1e-03
juvenile dermatomyositis 1.157 5.6e-12
lung adenocarcinoma 1.079 2.2e-04
lung cancer 1.500 1.3e-03
medulloblastoma, large-cell -1.700 4.0e-05
non-small cell lung cancer 1.353 2.5e-10
oligodendroglioma -2.100 1.7e-02
osteosarcoma -1.367 1.1e-04
ovarian cancer -4.600 2.8e-12
Pick disease -1.200 2.6e-04
pituitary cancer -1.100 4.5e-05
primitive neuroectodermal tumor -1.200 3.5e-02
psoriasis 1.100 8.8e-09
Rheumatoid arthritis 1.400 1.4e-03
tuberculosis and treatment for 3 months -1.200 1.4e-03

Synonym

Accession O00214 O15215 Q5T3P5 Q5T3Q4 Q8TEV1 Q96B92 Q9BXC8 Q9H584 Q9H585 Q9UEZ6 Q9UP32 Q9UP33 Q9UP34 Gal-8
Symbols Gal-8
PCTA1
PCTA-1
Po66-CBP

Gene

PANTHER Protein Class (1)

PDB

2YRO   2YV8   2YXS   3AP4   3AP5   3AP6   3AP7   3AP9   3APB   3OJB   3VKL   3VKM   3VKN   3VKO   4BMB   4BME   4FQZ   4GXL   4HAN   5GZC   5GZD   5GZE   5GZF   5GZG   5T7I   5T7S   5T7T   5T7U  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (48)

AA Sequence

MMLSLNNLQNIIYNPVIPFVGTIPDQLDPGTLIVIRGHVPSDADRFQVDLQNGSSMKPRADVAFHFNPRF      1 - 70
KRAGCIVCNTLINEKWGREEITYDTPFKREKSFEIVIMVLKDKFQVAVNGKHTLLYGHRIGPEKIDTLGI     71 - 140
YGKVNIHSIGFSFSSDLQSTQASSLELTEISRENVPKSGTPQLRLPFAARLNTPMGPGRTVVVKGEVNAN    141 - 210
AKSFNVDLLAGKSKDIALHLNPRLNIKAFVRNSFLQESWGEEERNITSFPFSPGMYFEMIIYCDVREFKV    211 - 280
AVNGVHSLEYKHRFKELSSIDTLEINGDIHLLEVRSW                                     281 - 317
//

Text Mined References (70)

PMID Year Title