Property Summary

NCBI Gene PubMed Count 64
Grant Count 5
R01 Count 3
Funding $1,073,171
PubMed Score 118.91
PubTator Score 110.36

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
Rheumatoid Arthritis 1.400 0.001
astrocytic glioma -1.900 0.012
ependymoma -1.800 0.023
oligodendroglioma -2.100 0.017
psoriasis 1.800 0.000
osteosarcoma -2.506 0.000
atypical teratoid / rhabdoid tumor -1.700 0.000
medulloblastoma -1.300 0.000
medulloblastoma, large-cell -1.700 0.000
primitive neuroectodermal tumor -1.200 0.035
juvenile dermatomyositis 1.157 0.000
tuberculosis and treatment for 3 months -1.200 0.001
non-small cell lung cancer 1.353 0.000
lung cancer 1.500 0.001
cystic fibrosis -1.100 0.000
adult high grade glioma -1.300 0.001
lung adenocarcinoma 1.079 0.000
non-inflammatory breast cancer 1.200 0.012
breast carcinoma 1.500 0.000
Pick disease -1.500 0.000
ductal carcinoma in situ 1.200 0.014
invasive ductal carcinoma 2.500 0.004
ovarian cancer -4.600 0.000
pituitary cancer -1.100 0.000

Synonym

Accession O00214 O15215 Q5T3P5 Q5T3Q4 Q8TEV1 Q96B92 Q9BXC8 Q9H584 Q9H585 Q9UEZ6 Q9UP32 Q9UP33 Q9UP34 Gal-8
Symbols Gal-8
PCTA1
PCTA-1
Po66-CBP

Gene

PANTHER Protein Class (1)

PDB

2YRO   2YV8   2YXS   3AP4   3AP5   3AP6   3AP7   3AP9   3APB   3OJB   3VKL   3VKM   3VKN   3VKO   4BMB   4BME   4FQZ   4GXL   4HAN  

Gene RIF (43)

PMID Text
27066737 this study uncovers a unique molecular mechanism of lymphangiogenesis in which galectin-8-dependent crosstalk among VEGF-C, podoplanin and integrin pathways plays a key role.
25800007 Platelet-derived factor V/Va is generated following endocytosis of the plasma-derived molecule by the platelet precursor cells, megakaryocytes, via a two receptor system consisting of LRP-1 and an unidentified specific "binding site".
25573487 The fundamental roles of galectin-8 in human anaplastic large cell lymphoma
25499921 Gal-8 expression is a potential independent unfavorable prognostic indicator for postoperative recurrence of patients with localized pT1 clear cell renal cell carcinoma
24957054 these results not only confirm the pro-inflammatory role we have already proposed for Gal-8 in other cellular systems but also suggest that this lectin is orchestrating the interaction between leukocytes, platelets and endothelial cells
24939370 The implications of gal-8 in tumor angiogenesis remain to be further explored, but it is exciting to speculate that modulating gal-8-glycan interactions could be used to block lymphatic-vascular connections vital for metastasis
24788652 Whereas Galectin (Gal)-1, -3, and -8 triggered vascular endothelial growth factor (VEGF) release, only Gal-8 induced endostatin secretion.
24696431 We integrate here the available information on Gal-8 expression in different tumor types and attempt to elucidate associations of its expression and localization with tumor progression[review]
24418318 Focusing on the F19Y change in galectin-8, we study of consequences of a single-site substitution in the carbohydrate recognition domain of this family of cellular effectors.
23555773 analysis of how human Galectin-8C domain interacts with its glycan ligands
More...

AA Sequence

MMLSLNNLQNIIYNPVIPFVGTIPDQLDPGTLIVIRGHVPSDADRFQVDLQNGSSMKPRADVAFHFNPRF      1 - 70
KRAGCIVCNTLINEKWGREEITYDTPFKREKSFEIVIMVLKDKFQVAVNGKHTLLYGHRIGPEKIDTLGI     71 - 140
YGKVNIHSIGFSFSSDLQSTQASSLELTEISRENVPKSGTPQLRLPFAARLNTPMGPGRTVVVKGEVNAN    141 - 210
AKSFNVDLLAGKSKDIALHLNPRLNIKAFVRNSFLQESWGEEERNITSFPFSPGMYFEMIIYCDVREFKV    211 - 280
AVNGVHSLEYKHRFKELSSIDTLEINGDIHLLEVRSW                                     281 - 317
//

Text Mined References (65)

PMID Year Title
27066737 2016 Pathological lymphangiogenesis is modulated by galectin-8-dependent crosstalk between podoplanin and integrin-associated VEGFR-3.
25800007 2015 Mechanisms Regulating Acquisition of Platelet-Derived Factor V/Va by Megakaryocytes.
25573487 2015 Sialylation by ?-galactoside ?-2,6-sialyltransferase and N-glycans regulate cell adhesion and invasion in human anaplastic large cell lymphoma.
25499921 2015 Galectin-8 predicts postoperative recurrence of patients with localized T1 clear cell renal cell carcinoma.
25416956 2014 A proteome-scale map of the human interactome network.
24957054 2014 Galectin-8 elicits pro-inflammatory activities in the endothelium.
24939370 2014 Galectin-8: a matricellular lectin with key roles in angiogenesis.
24788652 2014 Control of angiogenesis by galectins involves the release of platelet-derived proangiogenic factors.
24696431 2014 Expression, localization and function of galectin-8, a tandem-repeat lectin, in human tumors.
24418318 2014 Natural single amino acid polymorphism (F19Y) in human galectin-8: detection of structural alterations and increased growth-regulatory activity on tumor cells.
More...