Property Summary

NCBI Gene PubMed Count 88
PubMed Score 200.76
PubTator Score 103.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
adult high grade glioma -1.200 2.0e-05
atypical teratoid / rhabdoid tumor -1.400 8.6e-08
glioblastoma -1.200 6.3e-09
lung carcinoma 1.300 1.7e-20
malignant mesothelioma -1.600 3.6e-06
medulloblastoma, large-cell -1.300 4.5e-06
osteosarcoma 1.333 3.3e-05
sonic hedgehog group medulloblastoma -1.100 2.7e-04
subependymal giant cell astrocytoma -1.395 2.2e-02

Protein-protein Interaction (9)

Gene RIF (52)

AA Sequence

MSVPSSLSQSAINANSHGGPALSLPLPLHAAHNQLLNAKLQATAVGPKDLRSAMGEGGGPEPGPANAKWL      1 - 70
KEGQNQLRRAATAHRDQNRNVTLTLAEEASQEPEMAPLGPKGLIHLYSELELSAHNAANRGLRGPGLIIS     71 - 140
TQEQGPDEGEEKAAGEAEEEEEDDDDEEEEEDLSSPPGLPEPLESVEAPPRPQALTDGPREHSKSASLLF    141 - 210
GMRNSAASDEDSSWATLSQGSPSYGSPEDTDSFWNPNAFETDSDLPAGWMRVQDTSGTYYWHIPTGTTQW    211 - 280
EPPGRASPSQGSSPQEESQLTWTGFAHGEGFEDGEFWKDEPSDEAPMELGLKEPEEGTLTFPAQSLSPEP    281 - 350
LPQEEEKLPPRNTNPGIKCFAVRSLGWVEMTEEELAPGRSSVAVNNCIRQLSYHKNNLHDPMSGGWGEGK    351 - 420
DLLLQLEDETLKLVEPQSQALLHAQPIISIRVWGVGRDSGRERDFAYVARDKLTQMLKCHVFRCEAPAKN    421 - 490
IATSLHEICSKIMAERRNARCLVNGLSLDHSKLVDVPFQVEFPAPKNELVQKFQVYYLGNVPVAKPVGVD    491 - 560
VINGALESVLSSSSREQWTPSHVSVAPATLTILHQQTEAVLGECRVRFLSFLAVGRDVHTFAFIMAAGPA    561 - 630
SFCCHMFWCEPNAASLSEAVQAACMLRYQKCLDARSQASTSCLPAPPAESVARRVGWTVRRGVQSLWGSL    631 - 700
KPKRLGAHTP                                                                701 - 710
//

Text Mined References (93)

PMID Year Title