Property Summary

NCBI Gene PubMed Count 84
Grant Count 106
R01 Count 51
Funding $8,906,462.71
PubMed Score 219.25
PubTator Score 103.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Synonym

Accession O00213 A1E379 A6NH82 A6NL69 B7Z1J5 B7Z1J6 B7Z2Y0 D3DQT2 Q7Z324 Q96A93 V9GYK0 V9GYT4
Symbols RIR
FE65
MGC:9072

Gene

PANTHER Protein Class (1)

PDB

2E45   2HO2   2IDH   2OEI   3D8D   3D8E   3D8F   3DXC   3DXD   3DXE  

Gene RIF (49)

PMID Text
26276215 Jagged1 is a novel binding partner of Fe65, and Fe65 may act as a novel effector of Jagged1 signaling.
26188042 FE65 influences APP degradation via the proteasome, and phosphorylation of FE65 Ser(610) by SGK1 regulates binding of FE65 to APP, APP turnover and processing.
26166158 Targeted enhancement of the signaling through the Fe65-cortactin pathway, by either HDAC6 inhibition or Tip60 activation, may lead to the development of new therapeutic drugs that are effective for patients with metastatic breast cancers.
25397632 A novel phosphorylation site was identified within Fe65 which mediates gene transcription.
24619425 Data indicate that Fe65 is a positive estrogen receptor alpha (ERalpha) transcriptional regulator.
24284412 The SV2A/FE65 interaction might play a role in synaptic signal transduction.
23572515 FE65 interactions with BLM and MCM proteins may contribute to the neuronal cell cycle re-entry observed in brains affected by Alzheimer's disease.
22902274 A ternary complex consisting of AICD, FE65, and TIP60 down-regulates Stathmin1.
22199353 Fe65 carries out different functions depending on its location in the regulation of Notch1 signaling.
21968187 Phosphorylation of LRP1 regulates the interaction with Fe65.
More...

AA Sequence

MSVPSSLSQSAINANSHGGPALSLPLPLHAAHNQLLNAKLQATAVGPKDLRSAMGEGGGPEPGPANAKWL      1 - 70
KEGQNQLRRAATAHRDQNRNVTLTLAEEASQEPEMAPLGPKGLIHLYSELELSAHNAANRGLRGPGLIIS     71 - 140
TQEQGPDEGEEKAAGEAEEEEEDDDDEEEEEDLSSPPGLPEPLESVEAPPRPQALTDGPREHSKSASLLF    141 - 210
GMRNSAASDEDSSWATLSQGSPSYGSPEDTDSFWNPNAFETDSDLPAGWMRVQDTSGTYYWHIPTGTTQW    211 - 280
EPPGRASPSQGSSPQEESQLTWTGFAHGEGFEDGEFWKDEPSDEAPMELGLKEPEEGTLTFPAQSLSPEP    281 - 350
LPQEEEKLPPRNTNPGIKCFAVRSLGWVEMTEEELAPGRSSVAVNNCIRQLSYHKNNLHDPMSGGWGEGK    351 - 420
DLLLQLEDETLKLVEPQSQALLHAQPIISIRVWGVGRDSGRERDFAYVARDKLTQMLKCHVFRCEAPAKN    421 - 490
IATSLHEICSKIMAERRNARCLVNGLSLDHSKLVDVPFQVEFPAPKNELVQKFQVYYLGNVPVAKPVGVD    491 - 560
VINGALESVLSSSSREQWTPSHVSVAPATLTILHQQTEAVLGECRVRFLSFLAVGRDVHTFAFIMAAGPA    561 - 630
SFCCHMFWCEPNAASLSEAVQAACMLRYQKCLDARSQASTSCLPAPPAESVARRVGWTVRRGVQSLWGSL    631 - 700
KPKRLGAHTP                                                                701 - 710
//

Text Mined References (88)

PMID Year Title
26276215 2015 Fe65 negatively regulates Jagged1 signaling by decreasing Jagged1 protein stability through the E3 ligase Neuralized-like 1.
26188042 2015 Phosphorylation of FE65 Ser610 by serum- and glucocorticoid-induced kinase 1 modulates Alzheimer's disease amyloid precursor protein processing.
26166158 2015 Fe65 Suppresses Breast Cancer Cell Migration and Invasion through Tip60 Mediated Cortactin Acetylation.
25397632 2015 Fe65 Ser228 is phosphorylated by ATM/ATR and inhibits Fe65-APP-mediated gene transcription.
24619425 2014 A novel function of the Fe65 neuronal adaptor in estrogen receptor action in breast cancer cells.
24284412 2014 Amyloid beta a4 precursor protein-binding family B member 1 (FE65) interactomics revealed synaptic vesicle glycoprotein 2A (SV2A) and sarcoplasmic/endoplasmic reticulum calcium ATPase 2 (SERCA2) as new binding proteins in the human brain.
24056087 2014 FE65 interacts with ADP-ribosylation factor 6 to promote neurite outgrowth.
23572515 2013 FE65 regulates and interacts with the Bloom syndrome protein in dynamic nuclear spheres - potential relevance to Alzheimer's disease.
22902274 2013 A ternary complex consisting of AICD, FE65, and TIP60 down-regulates Stathmin1.
22199353 2012 Dual regulation of notch1 signaling pathway by adaptor protein fe65.
More...