Property Summary

NCBI Gene PubMed Count 35
Grant Count 29
R01 Count 25
Funding $1,752,864.98
PubMed Score 147.03
PubTator Score 28.61

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (4)

Disease log2 FC p
malignant mesothelioma -1.900 0.000
esophageal adenocarcinoma -1.400 0.031
psoriasis 1.800 0.001
osteosarcoma 2.249 0.000

Gene RIF (27)

PMID Text
25746724 A novel signaling pathway involving RhoD and its binding partner WHAMM, regulate Golgi dynamics.
24736615 HIV-1 MA-induced upregulation of collagen-I and alpha-SMA expression is dependent on CXCR2 via the Rho/ROCK-1 pathway
24717605 It regulates relaxation of vascular smooth muscle.
24706358 Activated p42/44-MAP kinase, Rho GTPase.
23454120 RhoD interacts with ZIPK in a GTP-dependent manner and modulates stress fiber and focal adhesion reorganization.
23417980 Data from differentiating cultured erythroid precursor cells suggest that RhAG (Rh-associated glycoprotein) knockdown abolishes Rh blood group expression (RhoD; ICAM4 [intercellular adhesion molecule 4]; CD47 Rh-related antigen) in erythroid cells.
23087206 Data show that RhoD binds the actin nucleation-promoting factor WHAMM (WASp homologue associated with actin Golgi membranes and microtubules), as well as the related filamin A-binding protein FILIP1.
22776962 Fetal RHD detection in early pregnancy using a single-exon assay in a routine clinical setting is feasible and accurate after its implementation in an unselected pregnant population.
22665057 A GTPase-deficient mutant of RhoD, RhoDG26V, causes hyperplasia and perturbed differentiation of the epidermis.
22262769 HIV-1 MA-induced upregulation of collagen-I and alpha-SMA expression is dependent on CXCR2 via the Rho/ROCK-1 pathway
More...

AA Sequence

MTAAQAAGEEAPPGVRSVKVVLVGDGGCGKTSLLMVFADGAFPESYTPTVFERYMVNLQVKGKPVHLHIW      1 - 70
DTAGQDDYDRLRPLFYPDASVLLLCFDVTSPNSFDNIFNRWYPEVNHFCKKVPIIVVGCKTDLCKDKSLV     71 - 140
NKLRRNGLEPVTYHRGQEMARSVGAVAYLECSARLHDNVHAVFQEAAEVALSSRGRNFWRRITQGFCVVT    141 - 210
//

Text Mined References (39)

PMID Year Title
25746724 2015 RhoD is a Golgi component with a role in anterograde protein transport from the ER to the plasma membrane.
24717605 2014 [Role of the Rho-kinase pathway in pulmonary arterial hypertension].
24706358 2014 Paxillin mediates stretch-induced Rho signaling and endothelial permeability via assembly of paxillin-p42/44MAPK-GEF-H1 complex.
24102721 2013 RhoD binds the Rab5 effector Rabankyrin-5 and has a role in trafficking of the platelet-derived growth factor receptor.
23454120 2013 Interaction of RhoD and ZIP kinase modulates actin filament assembly and focal adhesion dynamics.
23417980 2013 In vitro generated Rh(null) red cells recapitulate the in vivo deficiency: a model for rare blood group phenotypes and erythroid membrane disorders.
23087206 2012 RhoD regulates cytoskeletal dynamics via the actin nucleation-promoting factor WASp homologue associated with actin Golgi membranes and microtubules.
22776962 2012 Noninvasive single-exon fetal RHD determination in a routine screening program in early pregnancy.
22665057 2013 RhoD participates in the regulation of cell-cycle progression and centrosome duplication.
20881960 2010 Hundreds of variants clustered in genomic loci and biological pathways affect human height.
More...