Property Summary

NCBI Gene PubMed Count 37
PubMed Score 159.21
PubTator Score 28.61

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7950 4.3e-08
malignant mesothelioma 3232 5.6e-06
psoriasis 6694 1.2e-03
esophageal adenocarcinoma 737 3.1e-02
Disease Target Count Z-score Confidence
Cataract 7 32 3.071 1.5

Expression

  Differential Expression (4)

Disease log2 FC p
esophageal adenocarcinoma -1.400 3.1e-02
malignant mesothelioma -1.900 5.6e-06
osteosarcoma 2.249 4.3e-08
psoriasis 1.800 1.2e-03

Gene RIF (29)

AA Sequence

MTAAQAAGEEAPPGVRSVKVVLVGDGGCGKTSLLMVFADGAFPESYTPTVFERYMVNLQVKGKPVHLHIW      1 - 70
DTAGQDDYDRLRPLFYPDASVLLLCFDVTSPNSFDNIFNRWYPEVNHFCKKVPIIVVGCKTDLCKDKSLV     71 - 140
NKLRRNGLEPVTYHRGQEMARSVGAVAYLECSARLHDNVHAVFQEAAEVALSSRGRNFWRRITQGFCVVT    141 - 210
//

Text Mined References (41)

PMID Year Title