Property Summary

NCBI Gene PubMed Count 46
Grant Count 44
R01 Count 27
Funding $6,931,178.99
PubMed Score 169.24
PubTator Score 32.02

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
esophageal adenocarcinoma -2.500 0.020
psoriasis 1.400 0.000

Gene RIF (26)

PMID Text
26739637 Since 1'-hydroxyestragole exposure readily produced DNA injury in B-13/H cells, these data suggest that cholangiocarcinomas generated in rats fed estragole may be dependent, in part, on SULT2B1 activation of the 1'-hydroxyestragole metabolite.
26169578 It metabolizes breast cancer drugs like afimoxifene and endoxifen by sulfation.
26121319 Overexpression of SULT2B1b is an independent prognostic indicator and promotes cell growth and invasion in colorectal carcinoma.
24682418 This study identified specific germline variations in estradiol metabolism-related pathways, namely CYP1B1, SULT2B1, and HSD17B2, as novel prognostic markers that are cumulatively associated with increased risk of prostate cancer progression
24277929 Data indicate that cholesterol sulfate (CS) and SULT2B1b inhibited gluconeogenesis by targeting the gluconeogenic factor hepatocyte nuclear factor 4alpha (HNF4alpha) in both cell cultures and human SULT2B1b transgenic mice.
24020383 The SULT2B1 isoforms have a unique 50 amino acid carboxy-terminal sequence that is not present in the other human SULT isoforms (review).
23593328 SULT2B1b expression promotes proliferation of hepatocellular carcinoma cells in vitro and in vivo, which may contribute to the progression of HCC.
23579488 SULT2B1 is induced by calcitriol activated vitamin D receptor in human prostate cancer cells.
21840698 In HT29 cells expression of SULT2B1 was enhanced by probiotic fermentation supernatants without aleurone.
21146170 Sulfation of 25-hydroxycholesterol by SULT2B1b plays an important role in the maintenance of intracellular lipid homeostasis via the LXR/SREBP-1c signaling pathway in endothelial cells.
More...

AA Sequence

MDGPAEPQIPGLWDTYEDDISEISQKLPGEYFRYKGVPFPVGLYSLESISLAENTQDVRDDDIFIITYPK      1 - 70
SGTTWMIEIICLILKEGDPSWIRSVPIWERAPWCETIVGAFSLPDQYSPRLMSSHLPIQIFTKAFFSSKA     71 - 140
KVIYMGRNPRDVVVSLYHYSKIAGQLKDPGTPDQFLRDFLKGEVQFGSWFDHIKGWLRMKGKDNFLFITY    141 - 210
EELQQDLQGSVERICGFLGRPLGKEALGSVVAHSTFSAMKANTMSNYTLLPPSLLDHRRGAFLRKGVCGD    211 - 280
WKNHFTVAQSEAFDRAYRKQMRGMPTFPWDEDPEEDGSPDPEPSPEPEPKPSLEPNTSLEREPRPNSSPS    281 - 350
PSPGQASETPHPRPS                                                           351 - 365
//

Text Mined References (48)

PMID Year Title
26739637 2016 Progenitor-derived hepatocyte-like (B-13/H) cells metabolise 1'-hydroxyestragole to a genotoxic species via a SULT2B1-dependent mechanism.
26169578 2015 Sulfation of afimoxifene, endoxifen, raloxifene, and fulvestrant by the human cytosolic sulfotransferases (SULTs): A systematic analysis.
26121319 2015 Overexpression of SULT2B1b is an independent prognostic indicator and promotes cell growth and invasion in colorectal carcinoma.
25416956 2014 A proteome-scale map of the human interactome network.
24941225 2014 Genetic variations affecting serum carcinoembryonic antigen levels and status of regional lymph nodes in patients with sporadic colorectal cancer from Southern China.
24682418 2014 Steroidogenic germline polymorphism predictors of prostate cancer progression in the estradiol pathway.
24277929 2014 Cholesterol sulfate and cholesterol sulfotransferase inhibit gluconeogenesis by targeting hepatocyte nuclear factor 4?.
24020383 2013 SULT2B1: unique properties and characteristics of a hydroxysteroid sulfotransferase family.
23593328 2013 Hydroxysteroid sulfotransferase SULT2B1b promotes hepatocellular carcinoma cells proliferation in vitro and in vivo.
23579488 2013 SULT2B1b sulfotransferase: induction by vitamin D receptor and reduced expression in prostate cancer.
More...