Property Summary

NCBI Gene PubMed Count 48
PubMed Score 178.16
PubTator Score 32.02

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
esophageal adenocarcinoma -2.500 2.0e-02
psoriasis 1.400 5.7e-12

Gene RIF (27)

AA Sequence

MDGPAEPQIPGLWDTYEDDISEISQKLPGEYFRYKGVPFPVGLYSLESISLAENTQDVRDDDIFIITYPK      1 - 70
SGTTWMIEIICLILKEGDPSWIRSVPIWERAPWCETIVGAFSLPDQYSPRLMSSHLPIQIFTKAFFSSKA     71 - 140
KVIYMGRNPRDVVVSLYHYSKIAGQLKDPGTPDQFLRDFLKGEVQFGSWFDHIKGWLRMKGKDNFLFITY    141 - 210
EELQQDLQGSVERICGFLGRPLGKEALGSVVAHSTFSAMKANTMSNYTLLPPSLLDHRRGAFLRKGVCGD    211 - 280
WKNHFTVAQSEAFDRAYRKQMRGMPTFPWDEDPEEDGSPDPEPSPEPEPKPSLEPNTSLEREPRPNSSPS    281 - 350
PSPGQASETPHPRPS                                                           351 - 365
//

Text Mined References (50)

PMID Year Title