Property Summary

NCBI Gene PubMed Count 43
PubMed Score 21.01
PubTator Score 23.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Disease Target Count Z-score Confidence
Hermansky Pudlak syndrome 2 1 0.0 0.0
Disease Target Count P-value
ependymoma 4679 2.3e-13
pituitary cancer 1972 4.8e-07
atypical teratoid / rhabdoid tumor 5112 7.0e-07
osteosarcoma 7950 3.7e-04
Rheumatoid arthritis 1191 1.8e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Disease Target Count Z-score Confidence
Motor neuron disease 49 0.0 0.7
Type 2 diabetes mellitus 272 0.0 1.9
Disease Target Count Z-score Confidence
Hermansky-Pudlak syndrome 42 6.471 3.2
Disease Target Count
HERMANSKY-PUDLAK SYNDROME 2 1

Expression

  Differential Expression (5)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.200 7.0e-07
ependymoma 1.100 2.3e-13
osteosarcoma 1.136 3.7e-04
pituitary cancer -1.100 4.8e-07
Rheumatoid arthritis 1.200 1.8e-02

Gene RIF (24)

AA Sequence

MSSNSFPYNEQSGGGEATELGQEATSTISPSGAFGLFSSDLKKNEDLKQMLESNKDSAKLDAMKRIVGMI      1 - 70
AKGKNASELFPAVVKNVASKNIEIKKLVYVYLVRYAEEQQDLALLSISTFQRALKDPNQLIRASALRVLS     71 - 140
SIRVPIIVPIMMLAIKEASADLSPYVRKNAAHAIQKLYSLDPEQKEMLIEVIEKLLKDKSTLVAGSVVMA    141 - 210
FEEVCPDRIDLIHKNYRKLCNLLVDVEEWGQVVIIHMLTRYARTQFVSPWKEGDELEDNGKNFYESDDDQ    211 - 280
KEKTDKKKKPYTMDPDHRLLIRNTKPLLQSRNAAVVMAVAQLYWHISPKSEAGIISKSLVRLLRSNREVQ    281 - 350
YIVLQNIATMSIQRKGMFEPYLKSFYVRSTDPTMIKTLKLEILTNLANEANISTLLREFQTYVKSQDKQF    351 - 420
AAATIQTIGRCATNILEVTDTCLNGLVCLLSNRDEIVVAESVVVIKKLLQMQPAQHGEIIKHMAKLLDSI    421 - 490
TVPVARASILWLIGENCERVPKIAPDVLRKMAKSFTSEDDLVKLQILNLGAKLYLTNSKQTKLLTQYILN    491 - 560
LGKYDQNYDIRDRTRFIRQLIVPNVKSGALSKYAKKIFLAQKPAPLLESPFKDRDHFQLGTLSHTLNIKA    561 - 630
TGYLELSNWPEVAPDPSVRNVEVIELAKEWTPAGKAKQENSAKKFYSESEEEEDSSDSSSDSESESGSES    631 - 700
GEQGESGEEGDSNEDSSEDSSSEQDSESGRESGLENKRTAKRNSKAKGKSDSEDGEKENEKSKTSDSSND    701 - 770
ESSSIEDSSSDSESESEPESESESRRVTKEKEKKTKQDRTPLTKDVSLLDLDDFNPVSTPVALPTPALSP    771 - 840
SLMADLEGLHLSTSSSVISVSTPAFVPTKTHVLLHRMSGKGLAAHYFFPRQPCIFGDKMVSIQITLNNTT    841 - 910
DRKIENIHIGEKKLPIGMKMHVFNPIDSLEPEGSITVSMGIDFCDSTQTASFQLCTKDDCFNVNIQPPVG    911 - 980
ELLLPVAMSEKDFKKEQGVLTGMNETSAVIIAAPQNFTPSVIFQKVVNVANVGAVPSGQDNIHRFAAKTV    981 - 1050
HSGSLMLVTVELKEGSTAQLIINTEKTVIGSVLLRELKPVLSQG                             1051 - 1094
//

Text Mined References (52)

PMID Year Title