Property Summary

NCBI Gene PubMed Count 31
Grant Count 43
R01 Count 17
Funding $3,824,035.42
PubMed Score 171.10
PubTator Score 76.32

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
astrocytic glioma -1.400 0.009
ependymoma -1.100 0.010
osteosarcoma -2.212 0.000
group 3 medulloblastoma 1.700 0.012
pilocytic astrocytoma -1.500 0.000
Pick disease 1.200 0.001
pituitary cancer -1.300 0.001
facioscapulohumeral dystrophy -1.300 0.019

Gene RIF (17)

PMID Text
23580416 our findings suggest that induction of the BH3-only protein Hrk is a critical step in 2-ME activation of the JNK-induced apoptotic pathway, targeting mitochondria by liberating proapoptotic protein Bak.
23192964 Diva binds peptides derived from the BH3 domain of several other proapoptotic Bcl-2 proteins, including mouse Harakiri, Bid, Bak and Bmf.
23090478 The BH3-only protein harakiri (HRK) is transactivated by ATF4 in severe hypoxia through direct binding of ATF4 to the promoter region.
22964433 SUZ12 promotes the proliferation of human EOC cells by inhibiting apoptosis and HRK is a novel SUZ12 target gene whose upregulation contributes to apoptosis induced by SUZ12 knockdown.
22773666 Data suggest that DP5 and PUMA/BBC3 (p53 up-regulated modulator of apoptosis/bcl-2-binding component 3) contribute to palmitate-induced apoptosis of pancreatic beta-cells via lipotoxic endoplasmic reticulum stress.
21731739 These results are used to propose a tentative structural model of how Harakiri works.
21209886 analysis of a novel interaction between Bcl-2 members Diva and Harakiri
20855536 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19641496 Aberrant 5'-CpG methylation status and loss of heterozygosity on 12q13.1 are associated with HRK expression in human malignancies, including prostate cancers, astrocytic tumors and primary central nervous system lymphomas. Review.
More...

AA Sequence

MCPCPLHRGRGPPAVCACSAGRLGLRSSAAQLTAARLKALGDELHQRTMWRRRARSRRAPAPGALPTYWP      1 - 70
WLCAAAQVAALAAWLLGRRNL                                                      71 - 91
//

Text Mined References (32)

PMID Year Title
23580416 2013 Hrk mediates 2-methoxyestradiol-induced mitochondrial apoptotic signaling in prostate cancer cells.
23192964 2012 Nuclear magnetic resonance study of protein-protein interactions involving apoptosis regulator Diva (Boo) and the BH3 domain of proapoptotic Bcl-2 members.
23090478 2012 ATF4 orchestrates a program of BH3-only protein expression in severe hypoxia.
22964433 2012 SUZ12 promotes human epithelial ovarian cancer by suppressing apoptosis via silencing HRK.
22773666 2012 Death protein 5 and p53-upregulated modulator of apoptosis mediate the endoplasmic reticulum stress-mitochondrial dialog triggering lipotoxic rodent and human ?-cell apoptosis.
22504421 2012 Common variants at 12q14 and 12q24 are associated with hippocampal volume.
22504417 2012 Identification of common variants associated with human hippocampal and intracranial volumes.
22005931 2012 Genome-wide association analysis of age-at-onset in Alzheimer's disease.
21731739 2011 Intrinsic order and disorder in the bcl-2 member harakiri: insights into its proapoptotic activity.
21666788 2011 Effects of chronic ascariasis and trichuriasis on cytokine production and gene expression in human blood: a cross-sectional study.
More...