Property Summary

NCBI Gene PubMed Count 44
PubMed Score 44.71
PubTator Score 34.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (29)

Disease log2 FC p
adult high grade glioma -2.100 8.1e-03
astrocytic glioma -1.500 1.8e-02
Astrocytoma, Pilocytic -1.900 2.1e-03
atypical teratoid / rhabdoid tumor -2.800 4.7e-04
Breast cancer -1.500 3.4e-05
cystic fibrosis 1.333 2.9e-03
ductal carcinoma in situ 2.300 4.6e-03
Endometriosis -1.671 1.5e-02
ependymoma -4.000 5.0e-03
facioscapulohumeral dystrophy -2.200 6.4e-04
glioblastoma -1.600 3.5e-03
group 3 medulloblastoma -4.200 5.1e-04
interstitial cystitis -1.400 2.8e-03
intraductal papillary-mucinous adenoma (... 1.100 7.9e-03
intraductal papillary-mucinous carcinoma... 1.400 1.7e-02
intraductal papillary-mucinous neoplasm ... 1.300 3.8e-02
invasive ductal carcinoma 2.400 9.2e-03
lung cancer -1.800 6.2e-03
lung carcinoma -2.500 2.0e-24
malignant mesothelioma -3.200 1.6e-07
medulloblastoma, large-cell -3.800 1.1e-03
oligodendroglioma -3.000 1.0e-02
ovarian cancer -4.800 6.1e-12
pancreatic cancer 1.200 7.0e-04
Pick disease -1.900 4.7e-02
pituitary cancer 1.700 1.6e-02
psoriasis 1.100 2.8e-06
spina bifida -1.331 4.3e-02
tuberculosis 1.600 7.6e-06

 IMPC Phenotype (1)

Protein-protein Interaction (11)

Gene RIF (22)

AA Sequence

MTDGDYDYLIKLLALGDSGVGKTTFLYRYTDNKFNPKFITTVGIDFREKRVVYNAQGPNGSSGKAFKVHL      1 - 70
QLWDTAGQERFRSLTTAFFRDAMGFLLMFDLTSQQSFLNVRNWMSQLQANAYCENPDIVLIGNKADLPDQ     71 - 140
REVNERQARELADKYGIPYFETSAATGQNVEKAVETLLDLIMKRMEQCVEKTQIPDTVNGGNSGNLDGEK    141 - 210
PPEKKCIC                                                                  211 - 218
//

Text Mined References (47)

PMID Year Title