Property Summary

NCBI Gene PubMed Count 42
Grant Count 25
Funding $5,371,574.05
PubMed Score 41.29
PubTator Score 34.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (29)

Disease log2 FC p
malignant mesothelioma -4.800 0.000
astrocytoma -1.900 0.000
posterior fossa group B ependymoma -4.100 0.000
oligodendroglioma -3.000 0.010
psoriasis 1.400 0.000
glioblastoma multiforme -2.200 0.000
medulloblastoma -4.300 0.000
cystic fibrosis 4.027 0.000
atypical teratoid / rhabdoid tumor -2.800 0.000
medulloblastoma, large-cell -3.800 0.001
tuberculosis 1.600 0.000
intraductal papillary-mucinous adenoma (... 3.000 0.001
intraductal papillary-mucinous carcinoma... 2.200 0.008
intraductal papillary-mucinous neoplasm ... 2.300 0.028
lung cancer -3.500 0.000
pancreatic cancer 1.300 0.000
interstitial cystitis -1.400 0.003
adult high grade glioma -2.100 0.008
pilocytic astrocytoma -1.900 0.002
Endometriosis -1.671 0.015
lung carcinoma -2.500 0.000
spina bifida -1.331 0.043
Pick disease -1.900 0.047
ductal carcinoma in situ 2.300 0.005
invasive ductal carcinoma 2.400 0.009
ovarian cancer -4.800 0.000
Breast cancer -1.500 0.000
pituitary cancer 1.700 0.016
facioscapulohumeral dystrophy -2.200 0.001

 GWAS Trait (1)

Gene RIF (21)

PMID Text
26913720 MiR-193a-3p and miR-193a-5p play important roles in osteosarcoma metastasis through down-regulation of the Rab27B and SRR genes and therefore may serve as useful biomarkers for the diagnosis of osteosarcoma
26845357 These data indicate that Rab27B is involved at a different steps of zymogen granule maturation and secretion, which is distinct from that of Rab3D.
26760980 decreased expression of Rab27A and Rab27B, especially Rab27A, closely correlated with tumor progression and are valuable prognostic indicators in colorectal cancer patients.
26418905 Data indicate that a significant correlation between rab GTP-binding protein (RAB27B) and p53 tumor suppressor protein (p53) expression was observed.
26348397 Data indicate that the secretion of microRNA miR-143, depends on rab GTP-binding proteins Rab7a and Rab27b.
26165699 Decreased invasion partly resulted from reduced expression and activation of MMP-9 after Rab27b knockdown. Downregulation of Rab27b also suppressed tumor growth in vivo.
25382899 Rab27B nuclear expression is correlated with several clinicopathological features of GIST patients, and it may serve as an unfavorable prognostic marker.
25261234 Silencing of the exocytotic RAB family members RAB27A or RAB27B halted miR23b and miR921 secretion and reduced cellular invasion.
23665896 Experimental data are reviewed with a focus on the secretory Rab27 family of small GTPases and their implications in cancer progression.
23390068 inhibiting V-ATPase activity by interfering agents and drugs might be an effective strategy for blocking Rab27B-dependent proinvasive secretory vesicle trafficking in ERalpha-positive breast cancer patients
More...

AA Sequence

MTDGDYDYLIKLLALGDSGVGKTTFLYRYTDNKFNPKFITTVGIDFREKRVVYNAQGPNGSSGKAFKVHL      1 - 70
QLWDTAGQERFRSLTTAFFRDAMGFLLMFDLTSQQSFLNVRNWMSQLQANAYCENPDIVLIGNKADLPDQ     71 - 140
REVNERQARELADKYGIPYFETSAATGQNVEKAVETLLDLIMKRMEQCVEKTQIPDTVNGGNSGNLDGEK    141 - 210
PPEKKCIC                                                                  211 - 218
//

Text Mined References (45)

PMID Year Title
26913720 2016 MiR-193a-3p and miR-193a-5p suppress the metastasis of human osteosarcoma cells by down-regulating Rab27B and SRR, respectively.
26845357 2016 Genetic deletion of Rab27B in pancreatic acinar cells affects granules size and has inhibitory effects on amylase secretion.
26760980 2015 Decreased expression of Rab27A and Rab27B correlates with metastasis and poor prognosis in colorectal cancer.
26418905 2016 Correlation Between RAB27B and p53 Expression and Overall Survival in Pancreatic Cancer.
26348397 2015 Rab7a and Rab27b control secretion of endothelial microRNA through extracellular vesicles.
26165699 2015 Hypomethylated Rab27b is a progression-associated prognostic biomarker of glioma regulating MMP-9 to promote invasion.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
25382899 2014 Prognostic value of Rab27B nuclear expression in gastrointestinal stromal tumors.
25261234 2014 Cellular disposal of miR23b by RAB27-dependent exosome release is linked to acquisition of metastatic properties.
More...