Property Summary

NCBI Gene PubMed Count 20
PubMed Score 214.82
PubTator Score 45.47

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count P-value
group 3 medulloblastoma 4104 1.7e-05
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Neurodegenerative disease 414 0.0 4.0
hereditary spastic paraplegia 318 0.0 4.0

Expression

  Differential Expression (1)

Disease log2 FC p
group 3 medulloblastoma 1.600 1.7e-05

Protein-protein Interaction (3)

Gene RIF (4)

AA Sequence

MISQFFILSSKGDPLIYKDFRGDSGGRDVAELFYRKLTGLPGDESPVVMHHHGRHFIHIRHSGLYLVVTT      1 - 70
SENVSPFSLLELLSRLATLLGDYCGSLGEGTISRNVALVYELLDEVLDYGYVQTTSTEMLRNFIQTEAVV     71 - 140
SKPFSLFDLSSVGLFGAETQQSKVAPSSAASRPVLSSRSDQSQKNEVFLDVVERLSVLIASNGSLLKVDV    141 - 210
QGEIRLKSFLPSGSEMRIGLTEEFCVGKSELRGYGPGIRVDEVSFHSSVNLDEFESHRILRLQPPQGELT    211 - 280
VMRYQLSDDLPSPLPFRLFPSVQWDRGSGRLQVYLKLRCDLLSKSQALNVRLHLPLPRGVVSLSQELSSP    281 - 350
EQKAELAEGALRWDLPRVQGGSQLSGLFQMDVPGPPGPPSHGLSTSASPLGLGPASLSFELPRHTCSGLQ    351 - 420
VRFLRLAFRPCGNANPHKWVRHLSHSDAYVIRI                                         421 - 453
//

Text Mined References (20)

PMID Year Title