Property Summary

NCBI Gene PubMed Count 106
Grant Count 27
R01 Count 12
Funding $3,258,313.41
PubMed Score 173.88
PubTator Score 177.01

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
pancreatic ductal adenocarcinoma liver m... -2.225 0.010
lung cancer -1.400 0.003
Breast cancer -2.300 0.000
psoriasis -1.100 0.000

Gene RIF (89)

PMID Text
26728378 Data show that the vector expressing mannose-binding lectin associated protein 19 (MAp19) has been prepared successfully, and can express the target protein (MAp19) in the eukaryotic cells (HeLa cells).
26382056 MBL2 and MASP2 deficiencies protect against the development of systemic inflammatory response after pediatric cardiac surgery.
25887173 Polymorphisms of mannose-binding lectin (rs7096206) and MASP-2 (rs2273346 and rs6695096) were associated with the susceptibility of tuberculosis, and there were gene-gene interactions among them.
25862418 Polymorphisms in MASP1 and MASP2 genes are associated with the susceptibility or protection to infectious diseases. (Review)
25533914 Because MASP-1 and MASP-2 have been shown to interact directly with blood coagulation, elevated levels of these proteins may play a role in the enhanced thrombotic environment and consequent vascular complications in diabetes.
25359215 TFPI inhibits lectin pathway of complement activation by direct interaction with MASP-2.
25318078 MASP2 gene polymorphisms and protein levels seem to play an important role in the development of rheumatic fever and establishment of rheumatic heart disease.
25312983 polymorphism of MASP-2 (rs6695096) gene was associated with susceptibility to tuberculosis.
25042985 Both ficolin-3 and MASP-2 levels correlated inversely with the time from the onset of the attack of hereditary angioedema until blood sampling
25038892 expression of MBL and MASP-2 is altered in ovarian cancer, possibly indicating involvement of the lectin pathway of complement activation in the disease
More...

AA Sequence

MRLLTLLGLLCGSVATPLGPKWPEPVFGRLASPGFPGEYANDQERRWTLTAPPGYRLRLYFTHFDLELSH      1 - 70
LCEYDFVKLSSGAKVLATLCGQESTDTERAPGKDTFYSLGSSLDITFRSDYSNEKPFTGFEAFYAAEDID     71 - 140
ECQVAPGEAPTCDHHCHNHLGGFYCSCRAGYVLHRNKRTCSALCSGQVFTQRSGELSSPEYPRPYPKLSS    141 - 210
CTYSISLEEGFSVILDFVESFDVETHPETLCPYDFLKIQTDREEHGPFCGKTLPHRIETKSNTVTITFVT    211 - 280
DESGDHTGWKIHYTSTAQPCPYPMAPPNGHVSPVQAKYILKDSFSIFCETGYELLQGHLPLKSFTAVCQK    281 - 350
DGSWDRPMPACSIVDCGPPDDLPSGRVEYITGPGVTTYKAVIQYSCEETFYTMKVNDGKYVCEADGFWTS    351 - 420
SKGEKSLPVCEPVCGLSARTTGGRIYGGQKAKPGDFPWQVLILGGTTAAGALLYDNWVLTAAHAVYEQKH    421 - 490
DASALDIRMGTLKRLSPHYTQAWSEAVFIHEGYTHDAGFDNDIALIKLNNKVVINSNITPICLPRKEAES    491 - 560
FMRTDDIGTASGWGLTQRGFLARNLMYVDIPIVDHQKCTAAYEKPPYPRGSVTANMLCAGLESGGKDSCR    561 - 630
GDSGGALVFLDSETERWFVGGIVSWGSMNCGEAGQYGVYTKVINYIPWIENIISDF                  631 - 686
//

Text Mined References (109)

PMID Year Title
26728378 2016 [Expression of mannose-binding lectin associated protein 19 (MAp19) in HeLa cells].
26382056 2016 Mannose-binding lectin (MBL) insufficiency protects against the development of systemic inflammatory response after pediatric cardiac surgery.
25930971 2015 A homozygous mutation in SLC1A4 in siblings with severe intellectual disability and microcephaly.
25887173 2015 Impact of MBL and MASP-2 gene polymorphism and its interaction on susceptibility to tuberculosis.
25862418 2015 MBL-associated serine proteases (MASPs) and infectious diseases.
25533914 2015 Plasma levels of mannan-binding lectin-associated serine proteases MASP-1 and MASP-2 are elevated in type 1 diabetes and correlate with glycaemic control.
25359215 2015 TFPI inhibits lectin pathway of complement activation by direct interaction with MASP-2.
25318078 2014 Association of MASP2 polymorphisms and protein levels with rheumatic fever and rheumatic heart disease.
25312983 2014 Impact of passive smoking, cooking with solid fuel exposure, and MBL/MASP-2 gene polymorphism upon susceptibility to tuberculosis.
25042985 2014 Activation of the ficolin-lectin pathway during attacks of hereditary angioedema.
More...