Property Summary

NCBI Gene PubMed Count 114
PubMed Score 183.97
PubTator Score 177.01

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
Breast cancer -2.300 5.0e-07
lung cancer -1.400 3.0e-03
pancreatic ductal adenocarcinoma liver m... -2.225 1.0e-02
psoriasis -1.100 4.6e-29

Gene RIF (97)

AA Sequence

MRLLTLLGLLCGSVATPLGPKWPEPVFGRLASPGFPGEYANDQERRWTLTAPPGYRLRLYFTHFDLELSH      1 - 70
LCEYDFVKLSSGAKVLATLCGQESTDTERAPGKDTFYSLGSSLDITFRSDYSNEKPFTGFEAFYAAEDID     71 - 140
ECQVAPGEAPTCDHHCHNHLGGFYCSCRAGYVLHRNKRTCSALCSGQVFTQRSGELSSPEYPRPYPKLSS    141 - 210
CTYSISLEEGFSVILDFVESFDVETHPETLCPYDFLKIQTDREEHGPFCGKTLPHRIETKSNTVTITFVT    211 - 280
DESGDHTGWKIHYTSTAQPCPYPMAPPNGHVSPVQAKYILKDSFSIFCETGYELLQGHLPLKSFTAVCQK    281 - 350
DGSWDRPMPACSIVDCGPPDDLPSGRVEYITGPGVTTYKAVIQYSCEETFYTMKVNDGKYVCEADGFWTS    351 - 420
SKGEKSLPVCEPVCGLSARTTGGRIYGGQKAKPGDFPWQVLILGGTTAAGALLYDNWVLTAAHAVYEQKH    421 - 490
DASALDIRMGTLKRLSPHYTQAWSEAVFIHEGYTHDAGFDNDIALIKLNNKVVINSNITPICLPRKEAES    491 - 560
FMRTDDIGTASGWGLTQRGFLARNLMYVDIPIVDHQKCTAAYEKPPYPRGSVTANMLCAGLESGGKDSCR    561 - 630
GDSGGALVFLDSETERWFVGGIVSWGSMNCGEAGQYGVYTKVINYIPWIENIISDF                  631 - 686
//

Text Mined References (117)

PMID Year Title