Property Summary

NCBI Gene PubMed Count 21
Grant Count 50
R01 Count 36
Funding $2,539,288.29
PubMed Score 27.98
PubTator Score 23.08

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (2)

Disease log2 FC p
medulloblastoma, large-cell -1.300 0.012
progressive supranuclear palsy -1.200 0.016

 GO Function (1)

Gene RIF (9)

PMID Text
25190515 In vitro interaction assays indicated that Doc2b is required to bridge the interaction between Munc18c and Munc18-1 in the macromolecular complex; Munc18c and Munc18-1 failed to associate in the absence of Doc2b
23700440 Munc18c gene expression in human adipose tissue is down-regulated in morbid obesity.
22390153 Western Blot data showed decreased expression (p < 0,05) of Munc18c and phospho-PKC Zeta in polycystic ovary-insulin resistant endometria (PCOSE-IR) with respect to the control.
21444687 The identify IR as the first known tyrosine kinase for Munc18c as part of a new insulin-signaling step in GLUT4 vesicle exocytosis.
20460426 Expression of the SNARE-interacting protein Munc18c is higher in skeletal muscle from patients with type 2 diabetes.
20416077 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19061073 These results indicate that insulin induces dynamic associations between PKCzeta, 80K-H, and munc18c and that 80K-H may act as a key signaling link between PKCzeta and munc18c in live cells.
18588921 Munc18-2 acts as a regulator of primary granule exocytosis, while Munc18-3 may preferentially regulate the fusion of secondary granules
15576373 Calpha activation and phosphorylation of syntaxin 4 and Munc18c are required for the cell surface expression of P-selectin and the consequent binding of neutrophils to endothelial cells.

AA Sequence

MAPPVAERGLKSVVWQKIKATVFDDCKKEGEWKIMLLDEFTTKLLASCCKMTDLLEEGITVVENIYKNRE      1 - 70
PVRQMKALYFITPTSKSVDCFLHDFASKSENKYKAAYIYFTDFCPDNLFNKIKASCSKSIRRCKEINISF     71 - 140
IPHESQVYTLDVPDAFYYCYSPDPGNAKGKDAIMETMADQIVTVCATLDENPGVRYKSKPLDNASKLAQL    141 - 210
VEKKLEDYYKIDEKSLIKGKTHSQLLIIDRGFDPVSTVLHELTFQAMAYDLLPIENDTYKYKTDGKEKEA    211 - 280
ILEEEDDLWVRIRHRHIAVVLEEIPKLMKEISSTKKATEGKTSLSALTQLMKKMPHFRKQITKQVVHLNL    281 - 350
AEDCMNKFKLNIEKLCKTEQDLALGTDAEGQKVKDSMRVLLPVLLNKNHDNCDKIRAILLYIFSINGTTE    351 - 420
ENLDRLIQNVKIENESDMIRNWSYLGVPIVPQSQQGKPLRKDRSAEETFQLSRWTPFIKDIMEDAIDNRL    421 - 490
DSKEWPYCSQCPAVWNGSGAVSARQKPRANYLEDRKNGSKLIVFVIGGITYSEVRCAYEVSQAHKSCEVI    491 - 560
IGSTHVLTPKKLLDDIKMLNKPKDKVSLIKDE                                          561 - 592
//

Text Mined References (25)

PMID Year Title
25190515 2014 Doc2b serves as a scaffolding platform for concurrent binding of multiple Munc18 isoforms in pancreatic islet ?-cells.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23700440 2013 Munc18c in adipose tissue is downregulated in obesity and is associated with insulin.
22390153 2012 Protein expression of PKCZ (Protein Kinase C Zeta), Munc18c, and Syntaxin-4 in the insulin pathway in endometria of patients with polycystic ovary syndrome (PCOS).
21897333 2011 Genes linked to energy metabolism and immunoregulatory mechanisms are associated with subcutaneous adipose tissue distribution in HIV-infected men.
21444687 2011 Munc18c phosphorylation by the insulin receptor links cell signaling directly to SNARE exocytosis.
21269460 2011 Initial characterization of the human central proteome.
20460426 2010 The SNARE protein SNAP23 and the SNARE-interacting protein Munc18c in human skeletal muscle are implicated in insulin resistance/type 2 diabetes.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20416077 2010 Identification of type 2 diabetes-associated combination of SNPs using support vector machine.
More...