Property Summary

NCBI Gene PubMed Count 21
PubMed Score 31.29
PubTator Score 23.08

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
medulloblastoma, large-cell 6241 1.2e-02
progressive supranuclear palsy 676 1.6e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8

Expression

  Differential Expression (2)

Disease log2 FC p
medulloblastoma, large-cell -1.300 1.2e-02
progressive supranuclear palsy -1.200 1.6e-02

Protein-protein Interaction (2)

Gene RIF (9)

AA Sequence

MAPPVAERGLKSVVWQKIKATVFDDCKKEGEWKIMLLDEFTTKLLASCCKMTDLLEEGITVVENIYKNRE      1 - 70
PVRQMKALYFITPTSKSVDCFLHDFASKSENKYKAAYIYFTDFCPDNLFNKIKASCSKSIRRCKEINISF     71 - 140
IPHESQVYTLDVPDAFYYCYSPDPGNAKGKDAIMETMADQIVTVCATLDENPGVRYKSKPLDNASKLAQL    141 - 210
VEKKLEDYYKIDEKSLIKGKTHSQLLIIDRGFDPVSTVLHELTFQAMAYDLLPIENDTYKYKTDGKEKEA    211 - 280
ILEEEDDLWVRIRHRHIAVVLEEIPKLMKEISSTKKATEGKTSLSALTQLMKKMPHFRKQITKQVVHLNL    281 - 350
AEDCMNKFKLNIEKLCKTEQDLALGTDAEGQKVKDSMRVLLPVLLNKNHDNCDKIRAILLYIFSINGTTE    351 - 420
ENLDRLIQNVKIENESDMIRNWSYLGVPIVPQSQQGKPLRKDRSAEETFQLSRWTPFIKDIMEDAIDNRL    421 - 490
DSKEWPYCSQCPAVWNGSGAVSARQKPRANYLEDRKNGSKLIVFVIGGITYSEVRCAYEVSQAHKSCEVI    491 - 560
IGSTHVLTPKKLLDDIKMLNKPKDKVSLIKDE                                          561 - 592
//

Text Mined References (25)

PMID Year Title