Property Summary

NCBI Gene PubMed Count 109
Grant Count 74
R01 Count 39
Funding $5,958,840.82
PubMed Score 173.35
PubTator Score 166.98

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
Rheumatoid Arthritis -1.500 0.024
cutaneous lupus erythematosus 2.700 0.000
osteosarcoma -1.256 0.006
astrocytoma 1.100 0.042
glioblastoma 1.200 0.004
tuberculosis 1.200 0.000
primary pancreatic ductal adenocarcinoma 1.045 0.011
interstitial cystitis 1.200 0.002
subependymal giant cell astrocytoma 1.641 0.003
pancreatic cancer 1.100 0.005

Synonym

Accession O00182 A7VJG6 F8W9W4 O14532 O75028 Q3B8N1 Q53FQ0 Q8WYQ7 Q9NQ58 Gal-9
Symbols HUAT
LGALS9A

Gene

PANTHER Protein Class (1)

PDB

2EAK   2EAL   2YY1   2ZHK   2ZHL   2ZHM   2ZHN   3LSD   3LSE   3NV1   3NV2   3NV3   3NV4   3WLU   3WV6  

Gene RIF (100)

PMID Text
27028892 Galectin-9 stimulated migration in human NK-92 cells by affecting F-actin polarization through the Rho/ROCK1 signaling pathway.
26891020 The integrative analysis of galectins(Gal-1, -3, -4, -9) discriminated IBD from other intestinal inflammatory conditions and could be used as potential mucosal biomarker.
26823850 The expression of Galectin-9 mRNA has a close relationship with pathological differentiation, tumor staging, and recurrence metastasis in hepatocellular carcinoma
26797414 Gal-9 suppresses the growth of GBC, possibly by inducing apoptosis and altering miRNA expression
26663989 Gal-9 suppressed T-helper 17 (Th17) and expanded regulatory T cells (Tregs), resulting in decreased IL-17 production and increased secretion of TGF-beta1
26582205 These results indicate the possibility that cooperative binding of oligosaccharide and neighboring polypeptide structures of monoclonal IgE to galectin-9 affects the overall affinity and specificity of the IgE-lectin interaction.
26475932 may contribute to elevated galectin-9 and adaptive immune inhibition in hepatitis C virus infection
26342682 an abnormal Tim-3/Gal-9 pathway was able to facilitate the development of preeclampsia.
26279267 TIM-3 and its ligand, galectin-9 (Gal-9), constitute an autocrine loop critical for leukemic stem cells self-renewal and development of human acute myeloid leukemia.
26260906 These findings suggest that Gal-9 can be a candidate of therapeutic target in the treatment of cholangiocarcinoma
More...

AA Sequence

MAFSGSQAPYLSPAVPFSGTIQGGLQDGLQITVNGTVLSSSGTRFAVNFQTGFSGNDIAFHFNPRFEDGG      1 - 70
YVVCNTRQNGSWGPEERKTHMPFQKGMPFDLCFLVQSSDFKVMVNGILFVQYFHRVPFHRVDTISVNGSV     71 - 140
QLSYISFQNPRTVPVQPAFSTVPFSQPVCFPPRPRGRRQKPPGVWPANPAPITQTVIHTVQSAPGQMFST    141 - 210
PAIPPMMYPHPAYPMPFITTILGGLYPSKSILLSGTVLPSAQRFHINLCSGNHIAFHLNPRFDENAVVRN    211 - 280
TQIDNSWGSEERSLPRKMPFVRGQSFSVWILCEAHCLKVAVDGQHLFEYYHRLRNLPTINRLEVGGDIQL    281 - 350
THVQT                                                                     351 - 355
//

Text Mined References (112)

PMID Year Title
27028892 2016 Reduced Expression of Galectin-9 Contributes to a Poor Outcome in Colon Cancer by Inhibiting NK Cell Chemotaxis Partially through the Rho/ROCK1 Signaling Pathway.
26891020 A galectin-specific signature in the gut delineates Crohn's disease and ulcerative colitis from other human inflammatory intestinal disorders.
26823850 2015 Expression of galectin-9 mRNA in hepatocellular carcinoma.
26797414 2016 Galectin-9: An anticancer molecule for gallbladder carcinoma.
26663989 2015 Serum Galectin-9 Levels Are Associated with Coronary Artery Disease in Chinese Individuals.
26582205 2016 Cooperative Interactions of Oligosaccharide and Peptide Moieties of a Glycopeptide Derived from IgE with Galectin-9.
26475932 2016 HCV-infected cells and differentiation increase monocyte immunoregulatory galectin-9 production.
26342682 2015 Upregulation of the Tim-3/Gal-9 pathway and correlation with the development of preeclampsia.
26279267 2015 A TIM-3/Gal-9 Autocrine Stimulatory Loop Drives Self-Renewal of Human Myeloid Leukemia Stem Cells and Leukemic Progression.
26260906 2015 Galectin-9 suppresses cholangiocarcinoma cell proliferation by inducing apoptosis but not cell cycle arrest.
More...