Property Summary

NCBI Gene PubMed Count 24
PubMed Score 72.36
PubTator Score 46.75

Knowledge Summary

Patent (15,059)

TINX Plot

  Disease Sources (2)

Disease Target Count
Hyperplasia 26
Disease Target Count P-value
oligodendroglioma 2849 1.40255456347118E-19
ependymoma 2514 1.52910848840647E-13
non-small cell lung cancer 2798 2.50898857203626E-13
atypical teratoid / rhabdoid tumor 4369 5.23521915573579E-11
malignant mesothelioma 3163 4.15352763458692E-8
pediatric high grade glioma 2712 4.31941519455111E-7
cystic fibrosis 1670 6.49338685069751E-7
glioblastoma 5572 6.50314964234364E-7
pancreatic cancer 2300 2.61378287243658E-6
medulloblastoma, large-cell 6234 1.03999801091023E-5
lung cancer 4473 3.17907374838932E-5
lung adenocarcinoma 2714 5.43842047137211E-5
medulloblastoma 1524 1.85575074059166E-4
pituitary cancer 1972 3.51174914137318E-4
subependymal giant cell astrocytoma 2287 3.79033441991424E-4
primitive neuroectodermal tumor 3031 6.25675867667118E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 8.5404866445746E-4
astrocytic glioma 2241 0.00243342516748978
pilocytic astrocytoma 3086 0.00378037789660768
ovarian cancer 8492 0.00432366995304623
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00444759696110016
Parkinson's disease 364 0.00874012093113765
invasive ductal carcinoma 2950 0.0090121535804783
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.017626483547361
ductal carcinoma in situ 1745 0.0221889011282156
spina bifida 1064 0.0366283294851718
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0382245499983254

Expression

Synonym

Accession O00180 Q13307 Q5T5E8
Symbols DPK
HOHO
K2P1
KCNO1
TWIK1
K2p1.1
TWIK-1

Gene

PDB

3UKM  

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
C. elegans OMA EggNOG

Gene RIF (8)

PMID Text
25001086 TWIK-1 protein possesses a hydrophobic barrier deep within the inner pore
22282804 study presents the 3.4 angstrom resolution crystal structure of a human K2P channel, K2P1; an extracellular cap domain located above the selectivity filter forms an ion pathway in which K(+) ions flow through side portals
21964404 Potassium channels, in particular K2P channels, are expressed and functional in the apical membrane of airway epithelial cells
21653227 ion selectivity of TWIK-1 K+ channels during pathological hypokalemia; a molecular basis for inward leak Na+ currents that could trigger or contribute to cardiac paradoxical depolarization in lowered [K+]o; mechanism for regulating cardiac excitability.
19959478 TWIK1 is internalized via a dynamin-dependent mechanism and addressed to the recycling endosomal compartment. Mutation in its cytoplasmic C terminus (I293A,I294A) stabilizes TWIK1 at the plasma membrane, resulting in robust currents.
19948975 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and genetic testing. (HuGE Navigator)
19571146 support TWIK-1 and TREK-1 as being the major components of the long-sought K(+) channels underlying the passive conductance of mature hippocampal astrocytes
15820677 Removal of the peptide adduct by SUMO protease reveals K2P1 to be a K+-selective, pH-sensitive, openly rectifying channel regulated by reversible peptide linkage.

AA Sequence

MLQSLAGSSCVRLVERHRSAWCFGFLVLGYLLYLVFGAVVFSSVELPYEDLLRQELRKLKRRFLEEHECL      1 - 70
SEQQLEQFLGRVLEASNYGVSVLSNASGNWNWDFTSALFFASTVLSTTGYGHTVPLSDGGKAFCIIYSVI     71 - 140
GIPFTLLFLTAVVQRITVHVTRRPVLYFHIRWGFSKQVVAIVHAVLLGFVTVSCFFFIPAAVFSVLEDDW    141 - 210
NFLESFYFCFISLSTIGLGDYVPGEGYNQKFRELYKIGITCYLLLGLIAMLVVLETFCELHELKKFRKMF    211 - 280
YVKKDKDEDQVHIIEHDQLSFSSITDQAAGMKEDQKQNEPFVATQSSACVDGPANH                  281 - 336
//

Text Mined References (33)

PMID Year Title
25530075 2015 The family of K2P channels: salient structural and functional properties.
25339226 2015 Silent but not dumb: how cellular trafficking and pore gating modulate expression of TWIK1 and THIK2.
25001086 2014 A hydrophobic barrier deep within the inner pore of the TWIK-1 K2P potassium channel.
23169818 2012 SUMOylation silences heterodimeric TASK potassium channels containing K2P1 subunits in cerebellar granule neurons.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22699663 2012 Genome-wide association study of periodontal pathogen colonization.
22431633 2012 TWIK1, a unique background channel with variable ion selectivity.
22282804 2012 Crystal structure of the human two-pore domain potassium channel K2P1.
21964404 2012 A role for two-pore K? channels in modulating Na? absorption and Cl? secretion in normal human bronchial epithelial cells.
21653227 2011 TWIK-1 two-pore domain potassium channels change ion selectivity and conduct inward leak sodium currents in hypokalemia.
More...