Property Summary

NCBI Gene PubMed Count 27
PubMed Score 80.55
PubTator Score 46.75

Knowledge Summary

Patent (15,059)

Expression

  Differential Expression (27)

Disease log2 FC p
adult high grade glioma -2.600 4.5e-04
astrocytic glioma -2.800 1.7e-03
Astrocytoma, Pilocytic -1.500 3.0e-03
atypical teratoid / rhabdoid tumor -3.500 3.6e-12
cystic fibrosis 1.499 2.6e-05
ductal carcinoma in situ 1.700 2.7e-02
ependymoma -3.200 4.0e-03
glioblastoma -2.600 1.0e-06
group 3 medulloblastoma -2.000 2.7e-02
intraductal papillary-mucinous adenoma (... 2.900 2.1e-04
intraductal papillary-mucinous carcinoma... 2.000 2.7e-03
intraductal papillary-mucinous neoplasm ... 1.900 3.6e-02
invasive ductal carcinoma 2.200 9.0e-03
lung adenocarcinoma 1.212 2.1e-04
lung cancer -2.000 2.1e-03
malignant mesothelioma 2.100 3.7e-06
medulloblastoma, large-cell -3.500 9.5e-06
non-small cell lung cancer 1.555 2.5e-13
oligodendroglioma -2.100 1.5e-02
ovarian cancer -1.300 4.3e-03
pancreatic cancer 1.800 4.2e-06
pancreatic ductal adenocarcinoma liver m... 1.957 3.8e-02
Parkinson's disease -1.400 8.7e-03
pituitary cancer -1.400 3.5e-04
primitive neuroectodermal tumor -3.300 3.6e-04
spina bifida -1.616 4.4e-02
subependymal giant cell astrocytoma -5.089 3.8e-04

Gene RIF (10)

AA Sequence

MLQSLAGSSCVRLVERHRSAWCFGFLVLGYLLYLVFGAVVFSSVELPYEDLLRQELRKLKRRFLEEHECL      1 - 70
SEQQLEQFLGRVLEASNYGVSVLSNASGNWNWDFTSALFFASTVLSTTGYGHTVPLSDGGKAFCIIYSVI     71 - 140
GIPFTLLFLTAVVQRITVHVTRRPVLYFHIRWGFSKQVVAIVHAVLLGFVTVSCFFFIPAAVFSVLEDDW    141 - 210
NFLESFYFCFISLSTIGLGDYVPGEGYNQKFRELYKIGITCYLLLGLIAMLVVLETFCELHELKKFRKMF    211 - 280
YVKKDKDEDQVHIIEHDQLSFSSITDQAAGMKEDQKQNEPFVATQSSACVDGPANH                  281 - 336
//

Text Mined References (35)

PMID Year Title