Property Summary

NCBI Gene PubMed Count 24
Grant Count 31
R01 Count 23
Funding $4,223,657.78
PubMed Score 72.36
PubTator Score 46.75

Knowledge Summary

Patent (15,059)

Expression

Gene RIF (8)

PMID Text
25001086 TWIK-1 protein possesses a hydrophobic barrier deep within the inner pore
22282804 study presents the 3.4 angstrom resolution crystal structure of a human K2P channel, K2P1; an extracellular cap domain located above the selectivity filter forms an ion pathway in which K(+) ions flow through side portals
21964404 Potassium channels, in particular K2P channels, are expressed and functional in the apical membrane of airway epithelial cells
21653227 ion selectivity of TWIK-1 K+ channels during pathological hypokalemia; a molecular basis for inward leak Na+ currents that could trigger or contribute to cardiac paradoxical depolarization in lowered [K+]o; mechanism for regulating cardiac excitability.
19959478 TWIK1 is internalized via a dynamin-dependent mechanism and addressed to the recycling endosomal compartment. Mutation in its cytoplasmic C terminus (I293A,I294A) stabilizes TWIK1 at the plasma membrane, resulting in robust currents.
19948975 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and genetic testing. (HuGE Navigator)
19571146 support TWIK-1 and TREK-1 as being the major components of the long-sought K(+) channels underlying the passive conductance of mature hippocampal astrocytes
15820677 Removal of the peptide adduct by SUMO protease reveals K2P1 to be a K+-selective, pH-sensitive, openly rectifying channel regulated by reversible peptide linkage.

AA Sequence

MLQSLAGSSCVRLVERHRSAWCFGFLVLGYLLYLVFGAVVFSSVELPYEDLLRQELRKLKRRFLEEHECL      1 - 70
SEQQLEQFLGRVLEASNYGVSVLSNASGNWNWDFTSALFFASTVLSTTGYGHTVPLSDGGKAFCIIYSVI     71 - 140
GIPFTLLFLTAVVQRITVHVTRRPVLYFHIRWGFSKQVVAIVHAVLLGFVTVSCFFFIPAAVFSVLEDDW    141 - 210
NFLESFYFCFISLSTIGLGDYVPGEGYNQKFRELYKIGITCYLLLGLIAMLVVLETFCELHELKKFRKMF    211 - 280
YVKKDKDEDQVHIIEHDQLSFSSITDQAAGMKEDQKQNEPFVATQSSACVDGPANH                  281 - 336
//

Text Mined References (33)

PMID Year Title
25530075 2015 The family of K2P channels: salient structural and functional properties.
25339226 2015 Silent but not dumb: how cellular trafficking and pore gating modulate expression of TWIK1 and THIK2.
25001086 2014 A hydrophobic barrier deep within the inner pore of the TWIK-1 K2P potassium channel.
23169818 2012 SUMOylation silences heterodimeric TASK potassium channels containing K2P1 subunits in cerebellar granule neurons.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22699663 2012 Genome-wide association study of periodontal pathogen colonization.
22431633 2012 TWIK1, a unique background channel with variable ion selectivity.
22282804 2012 Crystal structure of the human two-pore domain potassium channel K2P1.
21964404 2012 A role for two-pore K? channels in modulating Na? absorption and Cl? secretion in normal human bronchial epithelial cells.
21653227 2011 TWIK-1 two-pore domain potassium channels change ion selectivity and conduct inward leak sodium currents in hypokalemia.
More...