Property Summary

NCBI Gene PubMed Count 13
PubMed Score 337.40
PubTator Score 185.01

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
juvenile dermatomyositis 1.027 2.8e-09
non primary Sjogren syndrome sicca 1.200 2.4e-02
osteosarcoma -2.157 7.7e-07
ovarian cancer -1.200 2.4e-05

AA Sequence

MATERSRSAMDSPVPASMFAPEPSSPGAARAAAAAARLHGGFDSDCSEDGEALNGEPELDLTSKLVLVSP      1 - 70
TSEQYDSLLRQMWERMDEGCGETIYVIGQGSDGTEYGLSEADMEASYATVKSMAEQIEADVILLRERQEA     71 - 140
GGRVRDYLVRKRVGDNDFLEVRVAVVGNVDAGKSTLLGVLTHGELDNGRGFARQKLFRHKHEIESGRTSS    141 - 210
VGNDILGFDSEGNVVNKPDSHGGSLEWTKICEKSTKVITFIDLAGHEKYLKTTVFGMTGHLPDFCMLMVG    211 - 280
SNAGIVGMTKEHLGLALALNVPVFVVVTKIDMCPANILQETLKLLQRLLKSPGCRKIPVLVQSKDDVIVT    281 - 350
ASNFSSERMCPIFQISNVTGENLDLLKMFLNLLSPRTSYREEEPAEFQIDDTYSVPGVGTVVSGTTLRGL    351 - 420
IKLNDTLLLGPDPLGNFLSIAVKSIHRKRMPVKEVRGGQTASFALKKIKRSSIRKGMVMVSPRLNPQASW    421 - 490
EFEAEILVLHHPTTISPRYQAMVHCGSIRQTATILSMDKDCLRTGDKATVHFRFIKTPEYLHIDQRLVFR    491 - 560
EGRTKAVGTITKLLQTTNNSPMNSKPQQIKMQSTKKGPLTKRDEGGPSGGPAVGAPPPGDEASSVGAGQP    561 - 630
AASSNLQPQPKPSSGGRRRGGQRHKVKSQGACVTPASGC                                   631 - 669
//

Text Mined References (21)

PMID Year Title