Property Summary

NCBI Gene PubMed Count 54
Grant Count 41
R01 Count 15
Funding $3,216,399.23
PubMed Score 83.72
PubTator Score 73.73

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
tuberculosis and treatment for 3 months -1.500 0.000
active Crohn's disease 1.446 0.002
interstitial cystitis 1.100 0.001
ulcerative colitis 1.300 0.000

 GO Component (1)

Gene RIF (41)

PMID Text
25774667 HMGB1 did not elicit chemotaxis of human eosinophils alone and had no effect in combination with the eosinophil chemotactic agent, eotaxin-2 (CCL24).
24989688 these data suggest that CCL26 and CCL24 are likely involved in the pathogenesis of chronic nasal hypereosinophilia, with a complex cooperation and different involvement of the various members of eotaxin family.
24600981 CCL11, CCL24, and CCL26 are increased in TB patients; hence, it seems that TB suppresses Th1 and the classic function of macrophages subsequently by inducing the chemokines' expression
23696919 Pregnancy associated environments increased local CCL24/CCR3, supporting the process of decidualization in human early pregnancy.
23477905 CCL11, CCL24, and CCL26 has a role in the recruitment of extravillous trophoblast into decidual tissue and vessels.
23025269 Study shows that CCL24 levels were significantly increased in age-related macular degeneration (AMD) patients despite Avastin treatment as compared with normal controls and those without Avastin.
22946025 Phosphodiesterase 4 inhibitors, rolipram and RO-20-1724 have no effect on CCL24 expression in human primary bronchial epithelial cells.
22846146 The level of eotaxin expression and inflammatory cell count were measured in the material from nasal brushing in healthy controls and in patients with allergic rhinitis, asthma, and chronic obstructive pulmonary disease.
21077277 Serum CCL11 was increased in ulcerative colitis (UC) and less in Crohn's disease (CD), whereas CCL24 and CCL26 were increased only in UC. Colon expression of the CCL's was higher in UC vs. CD, and was induced by Th2 cytokines in colon epithelial cells.
20659406 CCR3 is differentially expressed on inflammatory cells in rheumatoid arthritis, while eotaxin-2, a potent CCR3 agonist, is differentially expressed in active disease.
More...

AA Sequence

MAGLMTIVTSLLFLGVCAHHIIPTGSVVIPSPCCMFFVSKRIPENRVVSYQLSSRSTCLKAGVIFTTKKG      1 - 70
QQFCGDPKQEWVQRYMKNLDAKQKKASPRARAVAVKGPVQRYPGNQTTC                          71 - 119
//

Text Mined References (55)

PMID Year Title
25774667 2015 Physiologic concentrations of HMGB1 have no impact on cytokine-mediated eosinophil survival or chemotaxis in response to Eotaxin-2 (CCL24).
24989688 2014 Nasal fluid release of eotaxin-3 and eotaxin-2 in persistent sinonasal eosinophilic inflammation.
24600981 2014 All eotaxins CCL11, CCL24 and CCL26 are increased but to various extents in pulmonary tuberculosis patients.
23696919 2013 Trophoblasts-derived chemokine CCL24 promotes the proliferation, growth and apoptosis of decidual stromal cells in human early pregnancy.
23477905 2013 Control of extravillous trophoblast function by the eotaxins CCL11, CCL24 and CCL26.
23025269 2012 New biomarker for neovascular age-related macular degeneration: eotaxin-2.
22946025 2012 PDE4 inhibitors have no effect on eotaxin expression in human primary bronchial epithelial cells.
22846146 2012 Expression of eotaxins in the material from nasal brushing in asthma, allergic rhinitis and COPD patients.
21077277 2010 Increased expression of chemokine receptor CCR3 and its ligands in ulcerative colitis: the role of colonic epithelial cells in in vitro studies.
20659406 Decreased levels of CCR3 in CD4+ lymphocytes of rheumatoid arthritis patients.
More...