Property Summary

NCBI Gene PubMed Count 57
PubMed Score 90.93
PubTator Score 73.73

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
active Crohn's disease 1.446 1.8e-03
interstitial cystitis 1.100 7.2e-04
tuberculosis -1.400 2.3e-07
ulcerative colitis 1.300 3.6e-04

 GO Component (1)

Gene RIF (43)

AA Sequence

MAGLMTIVTSLLFLGVCAHHIIPTGSVVIPSPCCMFFVSKRIPENRVVSYQLSSRSTCLKAGVIFTTKKG      1 - 70
QQFCGDPKQEWVQRYMKNLDAKQKKASPRARAVAVKGPVQRYPGNQTTC                          71 - 119
//

Text Mined References (58)

PMID Year Title