Property Summary

NCBI Gene PubMed Count 99
Grant Count 41
R01 Count 31
Funding $3,572,895.96
PubMed Score 81.76
PubTator Score 133.91

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
diabetes mellitus -1.200 0.001
adult high grade glioma -1.300 0.000

Gene RIF (77)

PMID Text
26792934 No digenism with AIP was identified among patients with sporadic pituitary adenomas.
26187128 AIP mutations are associated with pituitary gigantism.
26139345 a small angle X-ray scattering-derived solution structure of aryl hydrocarbon receptor-interacting protein-like 1 (AIPL1) and functional properties of disease-linked AIPL1-proline-rich domain mutants
26021842 The prevalence of AIP(mut) in Turkish patients was found to be 1 % in sporadic acromegaly in the present study.
25938168 The aim of this study was to examine mutations in the aryl hydrocarbon receptor-interacting protein (AIP) gene
25911105 The interaction between AIP and IRF7 is enhanced upon virus infection, and AIP potently inhibits IRF7-induced type I IFN (IFN-alpha/beta) production.
25732638 traces the current state of knowledge regarding the clinical features of FIPA and the particular genetic, pathologic, and clinical characteristics of pituitary adenomas due to AIP mutations [review]
25245034 In T cells, transient binding of CARMA1 and AIP enhanced formation of the CBM complex. Thereby, AIP promoted optimal IKK/NF-kappaB signaling and IL-2 production in response to TCR/CD28 co-stimulation.
25184284 A relatively low prevalence of AIP gene mutations in young patients with apparently sporadic pituitary adenomas presenting to a tertiary pituitary UK centre.
25093619 The frequency of AIPmut in this registry-based cohort of young patients with acromegaly is lower than previously reported
More...

AA Sequence

MADIIARLREDGIQKRVIQEGRGELPDFQDGTKATFHYRTLHSDDEGTVLDDSRARGKPMELIIGKKFKL      1 - 70
PVWETIVCTMREGEIAQFLCDIKHVVLYPLVAKSLRNIAVGKDPLEGQRHCCGVAQMREHSSLGHADLDA     71 - 140
LQQNPQPLIFHMEMLKVESPGTYQQDPWAMTDEEKAKAVPLIHQEGNRLYREGHVKEAAAKYYDAIACLK    141 - 210
NLQMKEQPGSPEWIQLDQQITPLLLNYCQCKLVVEEYYEVLDHCSSILNKYDDNVKAYFKRGKAHAAVWN    211 - 280
AQEAQADFAKVLELDPALAPVVSRELQALEARIRQKDEEDKARFRGIFSH                        281 - 330
//

Text Mined References (100)

PMID Year Title
26792934 2016 Very low frequency of germline GPR101 genetic variation and no biallelic defects with AIP in a large cohort of patients with sporadic pituitary adenomas.
26187128 2015 Clinical and genetic characterization of pituitary gigantism: an international collaborative study in 208 patients.
26139345 2015 Extended conformation of the proline-rich domain of human aryl hydrocarbon receptor-interacting protein-like 1: implications for retina disease.
26021842 2015 Prevalence of AIP mutations in a series of Turkish acromegalic patients: are synonymous AIP mutations relevant?
25938168 2015 Do the aryl hydrocarbon receptor interacting protein variants (Q228K and Q307R) play a role in patients with familial and sporadic hormone-secreting pituitary adenomas?
25911105 2015 Aryl Hydrocarbon Receptor Interacting Protein Targets IRF7 to Suppress Antiviral Signaling and the Induction of Type I Interferon.
25732638 2015 Familial isolated pituitary adenomas (FIPA) and mutations in the aryl hydrocarbon receptor interacting protein (AIP) gene.
25245034 2014 AIP augments CARMA1-BCL10-MALT1 complex formation to facilitate NF-?B signaling upon T cell activation.
25184284 2014 Low rate of germline AIP mutations in patients with apparently sporadic pituitary adenomas before the age of 40: a single-centre adult cohort.
25093619 2014 Frequency of AIP gene mutations in young patients with acromegaly: a registry-based study.
More...