Property Summary

NCBI Gene PubMed Count 99
PubMed Score 81.76
PubTator Score 133.91

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
diabetes mellitus -1.200 0.001
adult high grade glioma -1.300 0.000

Synonym

Accession O00170 A0SZW3 A0SZW4 A0SZW5 A0SZW6 Q2M3Q2 Q99606 AIP
Symbols ARA9
XAP2
XAP-2
FKBP16
FKBP37
SMTPHN

Gene

AIP

PANTHER Protein Class (1)

PDB

2LKN   4AIF   4APO  

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA Inparanoid
Horse OMA Inparanoid
Cow OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid

Gene RIF (77)

PMID Text
26792934 No digenism with AIP was identified among patients with sporadic pituitary adenomas.
26187128 AIP mutations are associated with pituitary gigantism.
26139345 a small angle X-ray scattering-derived solution structure of aryl hydrocarbon receptor-interacting protein-like 1 (AIPL1) and functional properties of disease-linked AIPL1-proline-rich domain mutants
26021842 The prevalence of AIP(mut) in Turkish patients was found to be 1 % in sporadic acromegaly in the present study.
25938168 The aim of this study was to examine mutations in the aryl hydrocarbon receptor-interacting protein (AIP) gene
25911105 The interaction between AIP and IRF7 is enhanced upon virus infection, and AIP potently inhibits IRF7-induced type I IFN (IFN-alpha/beta) production.
25732638 traces the current state of knowledge regarding the clinical features of FIPA and the particular genetic, pathologic, and clinical characteristics of pituitary adenomas due to AIP mutations [review]
25245034 In T cells, transient binding of CARMA1 and AIP enhanced formation of the CBM complex. Thereby, AIP promoted optimal IKK/NF-kappaB signaling and IL-2 production in response to TCR/CD28 co-stimulation.
25184284 A relatively low prevalence of AIP gene mutations in young patients with apparently sporadic pituitary adenomas presenting to a tertiary pituitary UK centre.
25093619 The frequency of AIPmut in this registry-based cohort of young patients with acromegaly is lower than previously reported
More...

AA Sequence

MADIIARLREDGIQKRVIQEGRGELPDFQDGTKATFHYRTLHSDDEGTVLDDSRARGKPMELIIGKKFKL      1 - 70
PVWETIVCTMREGEIAQFLCDIKHVVLYPLVAKSLRNIAVGKDPLEGQRHCCGVAQMREHSSLGHADLDA     71 - 140
LQQNPQPLIFHMEMLKVESPGTYQQDPWAMTDEEKAKAVPLIHQEGNRLYREGHVKEAAAKYYDAIACLK    141 - 210
NLQMKEQPGSPEWIQLDQQITPLLLNYCQCKLVVEEYYEVLDHCSSILNKYDDNVKAYFKRGKAHAAVWN    211 - 280
AQEAQADFAKVLELDPALAPVVSRELQALEARIRQKDEEDKARFRGIFSH                        281 - 330
//

Text Mined References (100)

PMID Year Title
26792934 2016 Very low frequency of germline GPR101 genetic variation and no biallelic defects with AIP in a large cohort of patients with sporadic pituitary adenomas.
26187128 2015 Clinical and genetic characterization of pituitary gigantism: an international collaborative study in 208 patients.
26139345 2015 Extended conformation of the proline-rich domain of human aryl hydrocarbon receptor-interacting protein-like 1: implications for retina disease.
26021842 2015 Prevalence of AIP mutations in a series of Turkish acromegalic patients: are synonymous AIP mutations relevant?
25938168 2015 Do the aryl hydrocarbon receptor interacting protein variants (Q228K and Q307R) play a role in patients with familial and sporadic hormone-secreting pituitary adenomas?
25911105 2015 Aryl Hydrocarbon Receptor Interacting Protein Targets IRF7 to Suppress Antiviral Signaling and the Induction of Type I Interferon.
25732638 2015 Familial isolated pituitary adenomas (FIPA) and mutations in the aryl hydrocarbon receptor interacting protein (AIP) gene.
25245034 2014 AIP augments CARMA1-BCL10-MALT1 complex formation to facilitate NF-?B signaling upon T cell activation.
25184284 2014 Low rate of germline AIP mutations in patients with apparently sporadic pituitary adenomas before the age of 40: a single-centre adult cohort.
25093619 2014 Frequency of AIP gene mutations in young patients with acromegaly: a registry-based study.
More...