Property Summary

NCBI Gene PubMed Count 110
PubMed Score 85.96
PubTator Score 133.91

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count
Pituitary adenoma 38
Abnormal fear/anxiety-related behavior 1
Abnormality of hair density 2
Abnormality of nail of toe 11
Abnormality of the fingernails 51
Adrenocorticotropic hormone (ACTH) deficiency (disorder) 4
Adrenocorticotropin deficient adrenal insufficiency 4
Alkalosis 2
Anterior hypopituitarism 18
Anxiety 136
Anxiety disease 113
Arthralgia 90
Biconcave vertebral bodies 9
Blushing 4
Broad feet 19
Broad forehead 59
Broad jaw 3
Cardiomyopathies 110
Cerebral palsy 40
Chubby cheeks 50
Class III malocclusion 78
Coarse facial features 108
Collapse of vertebra 14
Compression fracture of vertebral column 14
Congenital macrodactylia 4
Cortical diaphyseal thickening of the upper limbs 1
Decreased circulating ACTH level 12
Decreased female libido 3
Decreased fertility in females 20
Decreased male fertility 7
Decreased visual acuity, progressive 36
Deep palmar crease 8
Deep plantar creases 5
Degenerative polyarthritis 115
Depressive disorder 409
Dysmenorrhea 21
Dyspareunia 12
Easy fatigability 18
Ecchymosis 66
Edema 81
Edema of eyelid 10
Erectile dysfunction 32
Facial erythema 4
Fatigue 182
Female hypogonadism syndrome 25
Frontal bossing 157
Full cheeks 50
Full lower lip 64
Galactorrhea 5
Generalized hirsutism 36
Generalized osteopenia 99
Growth hormone excess 14
Gynecomastia 64
Headache 37
Hirsutism 47
Hoarseness 31
Hyperhidrosis disorder 81
Hyperkyphosis 111
Hyperplasia of cheeks 50
Hyperprolactinemia 27
Hypertensive disease 292
Hypertrophy of cheeks 50
Hypertrophy of lower jaw 78
Hypogonadism, Isolated Hypogonadotropic 71
Hypogonadotropic hypogonadism 89
Hypokalemia 52
Hypotension 82
Impaired glucose tolerance 28
Increase in blood pressure 119
Increased circulating ACTH level 8
Increased serum IGF1 3
Increased size of mandible 78
Increased size of penis 7
Increased sweating 81
Increased tendency to bruise 66
Intermittent migraine headaches 68
Irregular periods 6
Joint swelling 26
Kyphosis deformity of spine 114
Large auricle 87
Large dysplastic ears 87
Large hand 18
Large pinnae 87
Large prominent ears 87
Large protruding ears 87
Large, floppy ears 87
Left Ventricular Hypertrophy 47
Linear atrophy 15
Long face 71
Macroglossia 65
Macrotia 87
Mandibular hyperplasia 78
Migraine Disorders 76
Mood swings 77
Nephrolithiasis 56
Neurogenic Muscular Atrophy 139
Neurogenic muscle atrophy, especially in the lower limbs 139
Non-Functioning Pituitary Gland Neoplasm 6
Obesity, Abdominal 24
Oligomenorrhea 16
Osteopenia 99
Osteoporosis 363
PITUITARY ADENOMA, FAMILIAL ISOLATED (disorder) 1
Pallor 40
Paresthesia 32
Pituitary growth hormone cell adenoma 8
Poor wound healing 8
Progressive visual loss 36
Prominent lower lip 64
Psychotic mentation 2
Puffy cheeks 50
Purpura 43
Rosacea 25
Ruddy face 4
Secondary growth hormone deficiency 2
Secondary hypothyroidism 15
Skeletal muscle atrophy 139
Sleep Apnea Syndromes 13
Somatic mutation 61
Somatotrophinoma, Familial 1
Spinal canal stenosis 12
Sweating 81
Synophrys 40
Tall stature 34
Tapering fingers (finding) 25
Testicular hypogonadism 21
Thickened facial skin with coarse facial features 108
Thin skin 47
Tires quickly 18
Vomiting 116
Wide nose 35
Widely spaced teeth 31
diabetes mellitus 1728
mandibular excess (physical finding) 78
menstrual periods stopped for over 6 months 13
muscle degeneration 139
Disease Target Count P-value
adult high grade glioma 3801 6.2e-05
Disease Target Count Z-score Confidence
Cushing's syndrome 48 0.0 4.0

Expression

  Differential Expression (2)

Disease log2 FC p
diabetes mellitus -1.200 1.1e-03
adult high grade glioma -1.300 6.2e-05

Protein-protein Interaction (2)

Gene RIF (87)

AA Sequence

MADIIARLREDGIQKRVIQEGRGELPDFQDGTKATFHYRTLHSDDEGTVLDDSRARGKPMELIIGKKFKL      1 - 70
PVWETIVCTMREGEIAQFLCDIKHVVLYPLVAKSLRNIAVGKDPLEGQRHCCGVAQMREHSSLGHADLDA     71 - 140
LQQNPQPLIFHMEMLKVESPGTYQQDPWAMTDEEKAKAVPLIHQEGNRLYREGHVKEAAAKYYDAIACLK    141 - 210
NLQMKEQPGSPEWIQLDQQITPLLLNYCQCKLVVEEYYEVLDHCSSILNKYDDNVKAYFKRGKAHAAVWN    211 - 280
AQEAQADFAKVLELDPALAPVVSRELQALEARIRQKDEEDKARFRGIFSH                        281 - 330
//

Text Mined References (111)

PMID Year Title