Property Summary

NCBI Gene PubMed Count 36
Grant Count 111
R01 Count 80
Funding $18,547,125.85
PubMed Score 480.51
PubTator Score 169.21

Knowledge Summary

Patent (10,241)

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.400 0.000

Synonym

Accession O00168 A8K196
Symbols PLM

Gene

PANTHER Protein Class (2)

PDB

2J1I   2JO1  

Gene RIF (24)

PMID Text
26791827 a period of high-intensity training with reduced training volume increases expression and phosphorylation levels of FXYD1, which may affect Na(+)/K(+) pump activity and muscle K(+) homeostasis during intense exercise.
26429909 Stopped-flow experiments using the dye RH421 show that FXYD1 slows the conformational transition E2(2K)ATP --> E1(3Na)ATP but does not affect 3NaE1P --> E2P3Na.
26410457 Study demonstrated that the expression of FXYD1, FXYD3 and FXYD5 is elevated in the lungs of Acute respiratory distress syndrome patients
25051342 the evolutionary conservation of G-quadruplex forming sequences with the confirmation of G-quadruplex formation in vitro by two FXYD1 homologues
23672825 Phospholemman is the target of a variety of post-translational modifications and these can dynamically alter the activity of the Na pump. [Review]
23224879 PLM regulates important ion transporters in the heart and offers a tempting target for development of drugs to treat heart failure.
22535957 Intracellular trafficking of FXYD1 (phospholemman) and FXYD7 proteins in Xenopus oocytes and mammalian cells.
22275761 the severity of the spinal cord lesion is an important factor controlling the expression of Na(+)-K(+)-ATPase and its regulatory protein PLM
21957166 Exercise induces FXYD1 phosphorylation at multiple sites in human muscle; in mice, contraction-induced changes in FXYD1 phosphorylation are fiber-type specific and dependent on protein kinase Calpha activity.
21849407 in left ventricular myocardium from patients with heart failure, PLM Ser-68 phosphorylation was approximately 50% lower than in nonfailing controls
More...

AA Sequence

MASLGHILVFCVGLLTMAKAESPKEHDPFTYDYQSLQIGGLVIAGILFILGILIVLSRRCRCKFNQQQRT      1 - 70
GEPDEEEGTFRSSIRRLSTRRR                                                     71 - 92
//

Text Mined References (38)

PMID Year Title
26791827 2016 Intensive training and reduced volume increases muscle FXYD1 expression and phosphorylation at rest and during exercise in athletes.
26429909 2015 Molecular Mechanisms and Kinetic Effects of FXYD1 and Phosphomimetic Mutants on Purified Human Na,K-ATPase.
26410457 2016 FXYD1 negatively regulates Na(+)/K(+)-ATPase activity in lung alveolar epithelial cells.
25051342 2014 G-quadruplex formation of FXYD1 pre-mRNA indicates the possibility of regulating expression of its protein product.
23672825 2013 Novel regulation of cardiac Na pump via phospholemman.
23224879 2013 Coordinated regulation of cardiac Na(+)/Ca (2+) exchanger and Na (+)-K (+)-ATPase by phospholemman (FXYD1).
22535957 2012 Intracellular trafficking of FXYD1 (phospholemman) and FXYD7 proteins in Xenopus oocytes and mammalian cells.
22275761 2012 Influence of chronic and acute spinal cord injury on skeletal muscle Na+-K+-ATPase and phospholemman expression in humans.
21957166 2011 Protein kinase C? activity is important for contraction-induced FXYD1 phosphorylation in skeletal muscle.
21868384 2011 The inhibitory effect of phospholemman on the sodium pump requires its palmitoylation.
More...