Property Summary

NCBI Gene PubMed Count 36
PubMed Score 552.24
PubTator Score 169.21

Knowledge Summary

Patent (10,241)

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.400 2.3e-36

Gene RIF (24)

AA Sequence

MASLGHILVFCVGLLTMAKAESPKEHDPFTYDYQSLQIGGLVIAGILFILGILIVLSRRCRCKFNQQQRT      1 - 70
GEPDEEEGTFRSSIRRLSTRRR                                                     71 - 92
//

Text Mined References (40)

PMID Year Title