Property Summary

NCBI Gene PubMed Count 39
PubMed Score 34.30
PubTator Score 24.36

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (10)

Disease log2 FC p
Breast cancer -1.900 3.7e-06
breast carcinoma -1.200 1.6e-04
colon cancer -2.800 5.9e-05
ependymoma 1.700 2.3e-03
esophageal adenocarcinoma -1.500 2.2e-02
group 3 medulloblastoma 3.500 1.7e-07
medulloblastoma, large-cell 3.800 3.4e-05
non-small cell lung cancer 1.573 4.0e-09
ovarian cancer 1.400 3.2e-02
ulcerative colitis -1.100 6.3e-03

Protein-protein Interaction (1)

Gene RIF (20)

AA Sequence

MVELVISPSLTVNSDCLDKLKFNRADAAVWTLSDRQGITKSAPLRVSQLFSRSCPRVLPRQPSTAMAAYG      1 - 70
QTQYSAGIQQATPYTAYPPPAQAYGIPSYSIKTEDSLNHSPGQSGFLSYGSSFSTSPTGQSPYTYQMHGT     71 - 140
TGFYQGGNGLGNAAGFGSVHQDYPSYPGFPQSQYPQYYGSSYNPPYVPASSICPSPLSTSTYVLQEASHN    141 - 210
VPNQSSESLAGEYNTHNGPSTPAKEGDTDRPHRASDGKLRGRSKRSSDPSPAGDNEIERVFVWDLDETII    211 - 280
IFHSLLTGTFASRYGKDTTTSVRIGLMMEEMIFNLADTHLFFNDLEDCDQIHVDDVSSDDNGQDLSTYNF    281 - 350
SADGFHSSAPGANLCLGSGVHGGVDWMRKLAFRYRRVKEMYNTYKNNVGGLIGTPKRETWLQLRAELEAL    351 - 420
TDLWLTHSLKALNLINSRPNCVNVLVTTTQLIPALAKVLLYGLGSVFPIENIYSATKTGKESCFERIMQR    421 - 490
FGRKAVYVVIGDGVEEEQGAKKHNMPFWRISCHADLEALRHALELEYL                          491 - 538
//

Text Mined References (39)

PMID Year Title