Property Summary

NCBI Gene PubMed Count 36
Grant Count 32
R01 Count 23
Funding $2,726,998.05
PubMed Score 29.96
PubTator Score 24.36

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
esophageal adenocarcinoma -1.500 0.022
posterior fossa group A ependymoma 2.600 0.000
group 3 medulloblastoma 3.500 0.000
medulloblastoma, large-cell 3.800 0.000
non-small cell lung cancer 1.573 0.000
colon cancer -2.800 0.000
breast carcinoma -1.200 0.000
Breast cancer -1.900 0.000
ulcerative colitis -1.200 0.013
ovarian cancer 1.400 0.032

MLP Assay (5)

AID Type Active / Inconclusive / Inactive Description
488837 confirmatory 21 / 4971 / 327395 qHTS Assay for Inhibitors of the Phosphatase Activity of Eya2
488939 summary 0 / 0 / 0 qHTS Assay for Inhibitors of the Phosphatase Activity of Eya2: Summary
504895 confirmatory 5 / 38 / 137 Inhibitors of Eya2ED: Hit Confirmation in Primary Screen
540357 other 2 / 0 / 0 Inhibitors of Eya2ED: Hit Confirmation in Malachite Green Secondary Assay
720540 confirmatory 462 / 502 / 318 qHTS for Inhibitors of the Phosphatase Activity of Eya2: Confirmatory Assay for Cherry-picked Compounds

Gene RIF (17)

PMID Text
25555392 SIX1 and EYA are often co-overexpressed in tumors, and the SIX1-EYA2 interaction has been shown to be critical for metastasis in a breast cancer model.
24810906 Decreased expression of EYA2 is associated with pancreatic adenocarcinomas.
24508260 MIR30A represses Eya2 expression by binding to the 3'-untranslated region of Eya2.The MIR30A/EYA2 axis regulates breast cancer cell proliferation and migration.
24196439 This interaction suggests that CDK6 regulates EYA2 activity, a mechanism that could be important in development and in cancer.
23435380 Given that SIX1 and EYA are overexpressed in many tumor types, our data indicate that targeting the SIX1-EYA complex may be a potent approach to inhibit tumor progression in multiple cancer types
22987659 Functional roles of candidate genes EYA2 (20q13) and hsa-miR-375 (2q35) were studied by siRNA-mediated knock-down and overexpression, respectively, in hrHPV-containing cell lines.
22607316 Studies indicate that the RNA and protein levels of Eya2 is upregulated in ovarian cancer.
21706047 Data implicate Eya2 as a necessary co-factor for many of the metastasis promoting functions of Six1.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
More...

AA Sequence

MVELVISPSLTVNSDCLDKLKFNRADAAVWTLSDRQGITKSAPLRVSQLFSRSCPRVLPRQPSTAMAAYG      1 - 70
QTQYSAGIQQATPYTAYPPPAQAYGIPSYSIKTEDSLNHSPGQSGFLSYGSSFSTSPTGQSPYTYQMHGT     71 - 140
TGFYQGGNGLGNAAGFGSVHQDYPSYPGFPQSQYPQYYGSSYNPPYVPASSICPSPLSTSTYVLQEASHN    141 - 210
VPNQSSESLAGEYNTHNGPSTPAKEGDTDRPHRASDGKLRGRSKRSSDPSPAGDNEIERVFVWDLDETII    211 - 280
IFHSLLTGTFASRYGKDTTTSVRIGLMMEEMIFNLADTHLFFNDLEDCDQIHVDDVSSDDNGQDLSTYNF    281 - 350
SADGFHSSAPGANLCLGSGVHGGVDWMRKLAFRYRRVKEMYNTYKNNVGGLIGTPKRETWLQLRAELEAL    351 - 420
TDLWLTHSLKALNLINSRPNCVNVLVTTTQLIPALAKVLLYGLGSVFPIENIYSATKTGKESCFERIMQR    421 - 490
FGRKAVYVVIGDGVEEEQGAKKHNMPFWRISCHADLEALRHALELEYL                          491 - 538
//

Text Mined References (36)

PMID Year Title
25555392 2015 The SIX1-EYA transcriptional complex as a therapeutic target in cancer.
24810906 2014 Epigenetic silencing of EYA2 in pancreatic adenocarcinomas promotes tumor growth.
24508260 2014 miR-30a suppresses breast cancer cell proliferation and migration by targeting Eya2.
24196439 2014 CDK6 binds and promotes the degradation of the EYA2 protein.
23435380 2013 Structure-function analyses of the human SIX1-EYA2 complex reveal insights into metastasis and BOR syndrome.
23400010 2014 Genome-wide association analyses suggest NELL1 influences adverse metabolic response to HCTZ in African Americans.
22987659 2013 Focal aberrations indicate EYA2 and hsa-miR-375 as oncogene and tumor suppressor in cervical carcinogenesis.
22607316 2013 Human HAD phosphatases: structure, mechanism, and roles in health and disease.
22589738 2012 Genome-wide association for abdominal subcutaneous and visceral adipose reveals a novel locus for visceral fat in women.
21706047 2012 Eya2 is required to mediate the pro-metastatic functions of Six1 via the induction of TGF-? signaling, epithelial-mesenchymal transition, and cancer stem cell properties.
More...