Property Summary

NCBI Gene PubMed Count 76
Grant Count 38
R01 Count 31
Funding $2,378,110.21
PubMed Score 99.20
PubTator Score 128.48

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.300 0.000
glioblastoma -1.400 0.000
medulloblastoma, large-cell -1.500 0.000
diabetes mellitus -1.200 0.004
adult high grade glioma -1.500 0.000
group 4 medulloblastoma -1.100 0.008
non primary Sjogren syndrome sicca 1.200 0.039

Gene RIF (65)

PMID Text
26997484 Kv3.3 regulates Arp2/3-dependent cortical actin nucleation mediated by Hax-1; resulting cortical actin structures interact with the channel's gating machinery to slow its inactivation rate during sustained membrane depolarizations; a mutation that leads to late-onset spinocerebellar ataxia type 13.
26339377 HAX-1 is overexpressed in hepatocellular carcinoma and promotes cell proliferation.
26323553 Results show that mRNA and protein levels of HAX-1 in prostate cancer cell lines were significantly higher and inhibits cell apoptosis through caspase-9 inactivation.
26062578 HAX1 knockdown significantly decreased the proliferation. In addition, the expression levels of ki67 and phosphorylatedakt were inhibited following HAX1 knockdown.
25554539 HAX-1 was significantly elevated in laryngeal carcinoma.
25419709 HAX1 is a proto-oncogene in mantle cell lymphoma.
25289648 HAX-1 is involved in mRNA processing as an element of P-body interaction network.
25284454 HAX1 mutation is associated with severe congenital neutropenia.
25275296 Authors showed that HAX1 promotes auto-ubiquitination and degradation of cIAPs by facilitating the intermolecular homodimerization of RING finger domain.
24910348 anti-apoptotic role of HAX-1 versus BCL-XL in cytokine-dependent bone marrow-derived cells
More...

AA Sequence

MSLFDLFRGFFGFPGPRSHRDPFFGGMTRDEDDDEEEEEEGGSWGRGNPRFHSPQHPPEEFGFGFSFSPG      1 - 70
GGIRFHDNFGFDDLVRDFNSIFSDMGAWTLPSHPPELPGPESETPGERLREGQTLRDSMLKYPDSHQPRI     71 - 140
FGGVLESDARSESPQPAPDWGSQRPFHRFDDVWPMDPHPRTREDNDLDSQVSQEGLGPVLQPQPKSYFKS    141 - 210
ISVTKITKPDGIVEERRTVVDSEGRTETTVTRHEADSSPRGDPESPRPPALDDAFSILDLFLGRWFRSR     211 - 279
//

Text Mined References (84)

PMID Year Title
26997484 2016 Kv3.3 Channels Bind Hax-1 and Arp2/3 to Assemble a Stable Local Actin Network that Regulates Channel Gating.
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26339377 2015 HAX-1 is overexpressed in hepatocellular carcinoma and promotes cell proliferation.
26323553 2015 HAX-1 inhibits apoptosis in prostate cancer through the suppression of caspase-9 activation.
26062578 2015 Expression of HAX-1 in colorectal cancer and its role in cancer cell growth.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25554539 2015 Clinical significance of HAX-1 expression in laryngeal carcinoma.
25419709 2014 Disruption of the PRKCD-FBXO25-HAX-1 axis attenuates the apoptotic response and drives lymphomagenesis.
25289648 2015 HAX-1: a novel p-body protein.
25284454 2015 Genetic analysis and clinical picture of severe congenital neutropenia in Israel.
More...