Property Summary

NCBI Gene PubMed Count 76
PubMed Score 99.20
PubTator Score 128.48

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (5)

Disease Target Count P-value
atypical teratoid / rhabdoid tumor 4369 2.58135534345255E-5
glioblastoma 5572 3.07796306064234E-5
medulloblastoma, large-cell 6234 1.58826341313783E-4
adult high grade glioma 2148 2.86371887188484E-4
diabetes mellitus 1663 0.00389608440771931
group 4 medulloblastoma 1875 0.0082815178243327
non primary Sjogren syndrome sicca 840 0.0389031355131013
Disease Target Count Z-score Confidence
Severe congenital neutropenia 10 0.0 5.0
Disease Target Count Z-score Confidence
Neutropenia 78 5.611 2.8
Spinocerebellar ataxia type 13 5 3.388 1.7

Expression

  Differential Expression (7)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.300 0.000
glioblastoma -1.400 0.000
medulloblastoma, large-cell -1.500 0.000
diabetes mellitus -1.200 0.004
adult high grade glioma -1.500 0.000
group 4 medulloblastoma -1.100 0.008
non primary Sjogren syndrome sicca 1.200 0.039

Synonym

Accession O00165 A8W4W9 A8W4X0 B4DUJ7 Q5VYD5 Q5VYD7 Q96AU4 Q9BS80
Symbols SCN3
HS1BP1
HCLSBP1

Gene

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid

Gene RIF (64)

PMID Text
26997484 Kv3.3 regulates Arp2/3-dependent cortical actin nucleation mediated by Hax-1; resulting cortical actin structures interact with the channel's gating machinery to slow its inactivation rate during sustained membrane depolarizations; a mutation that leads to late-onset spinocerebellar ataxia type 13.
26339377 HAX-1 is overexpressed in hepatocellular carcinoma and promotes cell proliferation.
26323553 Results show that mRNA and protein levels of HAX-1 in prostate cancer cell lines were significantly higher and inhibits cell apoptosis through caspase-9 inactivation.
26062578 HAX1 knockdown significantly decreased the proliferation. In addition, the expression levels of ki67 and phosphorylatedakt were inhibited following HAX1 knockdown.
25554539 HAX-1 was significantly elevated in laryngeal carcinoma.
25419709 HAX1 is a proto-oncogene in mantle cell lymphoma.
25289648 HAX-1 is involved in mRNA processing as an element of P-body interaction network.
25284454 HAX1 mutation is associated with severe congenital neutropenia.
25275296 Authors showed that HAX1 promotes auto-ubiquitination and degradation of cIAPs by facilitating the intermolecular homodimerization of RING finger domain.
24910348 anti-apoptotic role of HAX-1 versus BCL-XL in cytokine-dependent bone marrow-derived cells
More...

AA Sequence

MSLFDLFRGFFGFPGPRSHRDPFFGGMTRDEDDDEEEEEEGGSWGRGNPRFHSPQHPPEEFGFGFSFSPG      1 - 70
GGIRFHDNFGFDDLVRDFNSIFSDMGAWTLPSHPPELPGPESETPGERLREGQTLRDSMLKYPDSHQPRI     71 - 140
FGGVLESDARSESPQPAPDWGSQRPFHRFDDVWPMDPHPRTREDNDLDSQVSQEGLGPVLQPQPKSYFKS    141 - 210
ISVTKITKPDGIVEERRTVVDSEGRTETTVTRHEADSSPRGDPESPRPPALDDAFSILDLFLGRWFRSR     211 - 279
//

Text Mined References (84)

PMID Year Title
26997484 2016 Kv3.3 Channels Bind Hax-1 and Arp2/3 to Assemble a Stable Local Actin Network that Regulates Channel Gating.
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26339377 2015 HAX-1 is overexpressed in hepatocellular carcinoma and promotes cell proliferation.
26323553 2015 HAX-1 inhibits apoptosis in prostate cancer through the suppression of caspase-9 activation.
26062578 2015 Expression of HAX-1 in colorectal cancer and its role in cancer cell growth.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25554539 2015 Clinical significance of HAX-1 expression in laryngeal carcinoma.
25419709 2014 Disruption of the PRKCD-FBXO25-HAX-1 axis attenuates the apoptotic response and drives lymphomagenesis.
25289648 2015 HAX-1: a novel p-body protein.
25284454 2015 Genetic analysis and clinical picture of severe congenital neutropenia in Israel.
More...