Property Summary

NCBI Gene PubMed Count 82
PubMed Score 106.62
PubTator Score 128.48

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
adult high grade glioma -1.500 2.9e-04
atypical teratoid / rhabdoid tumor -1.300 2.6e-05
diabetes mellitus -1.200 3.9e-03
glioblastoma -1.400 3.1e-05
group 4 medulloblastoma -1.100 8.3e-03
medulloblastoma, large-cell -1.500 1.6e-04
non primary Sjogren syndrome sicca 1.200 3.9e-02

Gene RIF (69)

AA Sequence

MSLFDLFRGFFGFPGPRSHRDPFFGGMTRDEDDDEEEEEEGGSWGRGNPRFHSPQHPPEEFGFGFSFSPG      1 - 70
GGIRFHDNFGFDDLVRDFNSIFSDMGAWTLPSHPPELPGPESETPGERLREGQTLRDSMLKYPDSHQPRI     71 - 140
FGGVLESDARSESPQPAPDWGSQRPFHRFDDVWPMDPHPRTREDNDLDSQVSQEGLGPVLQPQPKSYFKS    141 - 210
ISVTKITKPDGIVEERRTVVDSEGRTETTVTRHEADSSPRGDPESPRPPALDDAFSILDLFLGRWFRSR     211 - 279
//

Text Mined References (90)

PMID Year Title