Property Summary

NCBI Gene PubMed Count 76
Grant Count 91
R01 Count 58
Funding $7,341,452.98
PubMed Score 129.25
PubTator Score 86.95

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession O00161 O00162 Q13602 Q6IAE3 SNAP-23
Symbols SNAP-23
SNAP23A
SNAP23B
HsT17016

Gene

PDB

1NHL   3ZUS  

Gene RIF (26)

PMID Text
26733245 Localization of SNAP23 was found in plasma membrane, lipid droplets and mitochondria of skeletal muscle.
26266817 these data suggest that SNAP23 is a key component of the endothelial SNARE machinery that mediates endothelial exocytosis.
24807903 Increased level of SNAP23-Syntaxin4-VAMP7 interaction correlates with decreased Syntaxin4 phosphorylation and trafficking of MT1-MMP to invadopodia during cellular invasion.
24496451 The association of Src, EGFR and beta1 integrin is dependent upon membrane traffic that is mediated by syntaxin13 (officially known as STX12) and SNAP23.
24373201 Data suggest SNAP23 and VAMP3 (vesicle-associated membrane protein 3) participate in interleukin-1beta-, interleukin-1 receptor-, calcium signaling-dependent secretion/exocytosis of interleukin-6 and tumor necrosis factor alpha from synoviocytes.
23087210 Results suggest that phagosomal SNAP-23 is one of the key players regulating the phagosomal environment in macrophages.
21981832 STX-3 and SNAP-23 are crucial for the release of all chemokines in mature human mast cells
21768361 Data show that knockdown of SNAP-23 inhibited the production of virus.
21642540 Introduction of the SNARE domain of SNAP-23 into neutrophils as an HIV transactivator of transcription (TAT) fusion protein significantly inhibits exocytosis of neutrophil granule subsets without altering signal transduction pathway activation.
20519516 SNAP23 and SNAP25 palmitoylation is regulated by DHHC palmitoyl transferases
More...

AA Sequence

MDNLSSEEIQQRAHQITDESLESTRRILGLAIESQDAGIKTITMLDEQKEQLNRIEEGLDQINKDMRETE      1 - 70
KTLTELNKCCGLCVCPCNRTKNFESGKAYKTTWGDGGENSPCNVVSKQPGPVTNGQLQQPTTGAASGGYI     71 - 140
KRITNDAREDEMEENLTQVGSILGNLKDMALNIGNEIDAQNPQIKRITDKADTNRDRIDIANARAKKLID    141 - 210
S//

Text Mined References (87)

PMID Year Title
26733245 2016 Immunofluorescence microscopy of SNAP23 in human skeletal muscle reveals colocalization with plasma membrane, lipid droplets, and mitochondria.
26359495 2015 The Q-soluble N-Ethylmaleimide-sensitive Factor Attachment Protein Receptor (Q-SNARE) SNAP-47 Regulates Trafficking of Selected Vesicle-associated Membrane Proteins (VAMPs).
26266817 2015 SNAP23 Regulates Endothelial Exocytosis of von Willebrand Factor.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25416956 2014 A proteome-scale map of the human interactome network.
24807903 2014 SNAP23, Syntaxin4, and vesicle-associated membrane protein 7 (VAMP7) mediate trafficking of membrane type 1-matrix metalloproteinase (MT1-MMP) during invadopodium formation and tumor cell invasion.
24705354 2014 The palmitoyl acyltransferase HIP14 shares a high proportion of interactors with huntingtin: implications for a role in the pathogenesis of Huntington's disease.
24496451 2014 SNARE-dependent interaction of Src, EGFR and ?1 integrin regulates invadopodia formation and tumor cell invasion.
24373201 2014 SNAP-23 and VAMP-3 contribute to the release of IL-6 and TNF? from a human synovial sarcoma cell line.
More...