Property Summary

NCBI Gene PubMed Count 13
PubMed Score 8.48
PubTator Score 5.16

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
adult high grade glioma 1.200 1.3e-02
astrocytoma 1.700 2.5e-02
Astrocytoma, Pilocytic 1.200 4.8e-06
chronic lymphosyte leukemia -1.100 2.9e-09
cutaneous lupus erythematosus 1.400 2.3e-03
glioblastoma 1.600 2.9e-03
interstitial cystitis 1.500 3.3e-03
lung carcinoma -2.000 1.3e-28
non-small cell lung cancer -1.601 3.5e-18
osteosarcoma -2.397 5.7e-03
ovarian cancer 1.600 1.7e-05
psoriasis 1.800 5.0e-04
subependymal giant cell astrocytoma 1.934 9.6e-03
ulcerative colitis 1.700 1.2e-05

Protein-protein Interaction (1)

Gene RIF (3)

AA Sequence

MGSKERFHWQSHNVKQSGVDDMVLLPQITEDAIAANLRKRFMDDYIFTYIGSVLISVNPFKQMPYFTDRE      1 - 70
IDLYQGAAQYENPPHIYALTDNMYRNMLIDCENQCVIISGESGAGKTVAAKYIMGYISKVSGGGEKVQHV     71 - 140
KDIILQSNPLLEAFGNAKTVRNNNSSRFGKYFEIQFSRGGEPDGGKISNFLLEKSRVVMQNENERNFHIY    141 - 210
YQLLEGASQEQRQNLGLMTPDYYYYLNQSDTYQVDGTDDRSDFGETLSAMQVIGIPPSIQQLVLQLVAGI    211 - 280
LHLGNISFCEDGNYARVESVDLLAFPAYLLGIDSGRLQEKLTSRKMDSRWGGRSESINVTLNVEQAAYTR    281 - 350
DALAKGLYARLFDFLVEAINRAMQKPQEEYSIGVLDIYGFEIFQKNGFEQFCINFVNEKLQQIFIELTLK    351 - 420
AEQEEYVQEGIRWTPIQYFNNKVVCDLIENKLSPPGIMSVLDDVCATMHATGGGADQTLLQKLQAAVGTH    421 - 490
EHFNSWSAGFVIHHYAGKVSYDVSGFCERNRDVLFSDLIELMQTSEQAFLRMLFPEKLDGDKKGRPSTAG    491 - 560
SKIKKQANDLVATLMRCTPHYIRCIKPNETKRPRDWEENRVKHQVEYLGLKENIRVRRAGFAYRRQFAKF    561 - 630
LQRYAILTPETWPRWRGDERQGVQHLLRAVNMEPDQYQMGSTKVFVKNPESLFLLEEVRERKFDGFARTI    631 - 700
QKAWRRHVAVRKYEEMREEASNILLNKKERRRNSINRNFVGDYLGLEERPELRQFLGKRERVDFADSVTK    701 - 770
YDRRFKPIKRDLILTPKCVYVIGREKVKKGPEKGQVCEVLKKKVDIQALRGVSLSTRQDDFFILQEDAAD    771 - 840
SFLESVFKTEFVSLLCKRFEEATRRPLPLTFSDTLQFRVKKEGWGGGGTRSVTFSRGFGDLAVLKVGGRT    841 - 910
LTVSVGDGLPKSSKPTRKGMAKGKPRRSSQAPTRAAPAPPRGMDRNGVPPSARGGPLPLEIMSGGGTHRP    911 - 980
PRGPPSTSLGASRRPRARPPSEHNTEFLNVPDQGMAGMQRKRSVGQRPVPGVGRPKPQPRTHGPRCRALY    981 - 1050
QYVGQDVDELSFNVNEVIEILMEDPSGWWKGRLHGQEGLFPGNYVEKI                         1051 - 1098
//

Text Mined References (16)

PMID Year Title