Property Summary

NCBI Gene PubMed Count 13
Grant Count 1
Funding $52,361.8
PubMed Score 7.78
PubTator Score 5.16

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
cutaneous lupus erythematosus 1.400 0.002
psoriasis 1.800 0.000
osteosarcoma -2.397 0.006
chronic lymphosyte leukemia -1.100 0.000
astrocytoma 1.700 0.025
glioblastoma 1.600 0.003
non-small cell lung cancer -1.601 0.000
interstitial cystitis 1.500 0.003
adult high grade glioma 1.200 0.013
pilocytic astrocytoma 1.200 0.000
subependymal giant cell astrocytoma 1.934 0.010
lung carcinoma -2.000 0.000
ulcerative colitis 1.700 0.000
ovarian cancer 1.600 0.000

Synonym

Accession O00160 Q8WWN7
Symbols

Gene

 Grant Application (1)

Gene RIF (3)

PMID Text
19027848 identification of 6 heterozygous missense mutations in MYO1C and additional 5 heterozygous missense mutations in MYO1F in bilateral sensorineural hearing loss
19027848 Observational study of gene-disease association. (HuGE Navigator)
18854154 Knockdown of myosin IF (MYO1F) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1

AA Sequence

MGSKERFHWQSHNVKQSGVDDMVLLPQITEDAIAANLRKRFMDDYIFTYIGSVLISVNPFKQMPYFTDRE      1 - 70
IDLYQGAAQYENPPHIYALTDNMYRNMLIDCENQCVIISGESGAGKTVAAKYIMGYISKVSGGGEKVQHV     71 - 140
KDIILQSNPLLEAFGNAKTVRNNNSSRFGKYFEIQFSRGGEPDGGKISNFLLEKSRVVMQNENERNFHIY    141 - 210
YQLLEGASQEQRQNLGLMTPDYYYYLNQSDTYQVDGTDDRSDFGETLSAMQVIGIPPSIQQLVLQLVAGI    211 - 280
LHLGNISFCEDGNYARVESVDLLAFPAYLLGIDSGRLQEKLTSRKMDSRWGGRSESINVTLNVEQAAYTR    281 - 350
DALAKGLYARLFDFLVEAINRAMQKPQEEYSIGVLDIYGFEIFQKNGFEQFCINFVNEKLQQIFIELTLK    351 - 420
AEQEEYVQEGIRWTPIQYFNNKVVCDLIENKLSPPGIMSVLDDVCATMHATGGGADQTLLQKLQAAVGTH    421 - 490
EHFNSWSAGFVIHHYAGKVSYDVSGFCERNRDVLFSDLIELMQTSEQAFLRMLFPEKLDGDKKGRPSTAG    491 - 560
SKIKKQANDLVATLMRCTPHYIRCIKPNETKRPRDWEENRVKHQVEYLGLKENIRVRRAGFAYRRQFAKF    561 - 630
LQRYAILTPETWPRWRGDERQGVQHLLRAVNMEPDQYQMGSTKVFVKNPESLFLLEEVRERKFDGFARTI    631 - 700
QKAWRRHVAVRKYEEMREEASNILLNKKERRRNSINRNFVGDYLGLEERPELRQFLGKRERVDFADSVTK    701 - 770
YDRRFKPIKRDLILTPKCVYVIGREKVKKGPEKGQVCEVLKKKVDIQALRGVSLSTRQDDFFILQEDAAD    771 - 840
SFLESVFKTEFVSLLCKRFEEATRRPLPLTFSDTLQFRVKKEGWGGGGTRSVTFSRGFGDLAVLKVGGRT    841 - 910
LTVSVGDGLPKSSKPTRKGMAKGKPRRSSQAPTRAAPAPPRGMDRNGVPPSARGGPLPLEIMSGGGTHRP    911 - 980
PRGPPSTSLGASRRPRARPPSEHNTEFLNVPDQGMAGMQRKRSVGQRPVPGVGRPKPQPRTHGPRCRALY    981 - 1050
QYVGQDVDELSFNVNEVIEILMEDPSGWWKGRLHGQEGLFPGNYVEKI                         1051 - 1098
//

Text Mined References (15)

PMID Year Title
20881960 2010 Hundreds of variants clustered in genomic loci and biological pathways affect human height.
19367720 2008 Phosphorylation analysis of primary human T lymphocytes using sequential IMAC and titanium oxide enrichment.
19027848 2009 Are MYO1C and MYO1F associated with hearing loss?
18391951 2008 Many sequence variants affecting diversity of adult human height.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...